Protein
MCA_01320_1
Length
160 amino acids
Gene name: MRPL23
Description: 54S ribosomal protein L23, mitochondrial
Browser: contigA:4148909-4149548+
RNA-seq: read pairs 4014, FPKM 308.1, percentile rank 92.0% (100% = highest expression)
Protein function
Annotation: | MRPL23 | 54S ribosomal protein L23, mitochondrial | |
---|---|---|---|
KEGG: | K02871 | RP-L13 | large subunit ribosomal protein L13 |
EGGNOG: | 0PN44 | MRPL23 | mitochondrial 54S ribosomal protein YmL23 |
SGD closest match: | S000005676 | MRPL23 | 54S ribosomal protein L23, mitochondrial |
CGD closest match: | CAL0000194298 | orf19.3348 | Mitochondrial 54S ribosomal protein YmL23 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XIX9_GEOCN | 80.50% | 159 | 4e-99 | Similar to Saccharomyces cerevisiae YOR150W MRPL23 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA17s02309g PE=3 SV=1 |
MIA_04679_1 | 83.23% | 155 | 6e-99 | MIA_04679_1 |
A0A1E3PP88_9ASCO | 64.05% | 153 | 1e-72 | Ribosomal protein L13 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50577 PE=3 SV=1 |
A0A060T821_BLAAD | 62.09% | 153 | 4e-70 | ARAD1D00308p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D00308g PE=3 SV=1 |
UniRef50_A0A1X7QZJ4 | 59.12% | 159 | 3e-62 | Similar to Saccharomyces cerevisiae YOR150W MRPL23 Mitochondrial ribosomal protein of the large subunit n=2 Tax=Fungi TaxID=4751 RepID=A0A1X7QZJ4_9SACH |
RM23_YEAST | 57.42% | 155 | 5e-62 | 54S ribosomal protein L23, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL23 PE=1 SV=1 |
A0A167CR85_9ASCO | 66.67% | 132 | 1e-60 | Mitochondrial 54S ribosomal protein YmL23 OS=Sugiyamaella lignohabitans GN=MRPL23 PE=3 SV=1 |
A0A1E4TA12_9ASCO | 56.55% | 145 | 1e-58 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27295 PE=3 SV=1 |
Q5A8Y6_CANAL | 51.88% | 160 | 3e-57 | Mitochondrial 54S ribosomal protein YmL23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3348 PE=3 SV=1 |
Q6C9L9_YARLI | 50.66% | 152 | 9e-53 | YALI0D10065p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10065g PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6181
Protein family membership
- Ribosomal protein L13 (IPR005822)
- Ribosomal protein L13, bacterial-type (IPR005823)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01366 (Ribosomal...)
-
SSF52161 (Ribosomal...)
-
cd00392 (Ribosomal_L13)
-
PF00572 (Ribosomal_L13)
-
PIRSF002181 (RPL13p...)
-
-
Residue annotation
-
23S rRNA interface...
-
L3 interface cd00392
Protein sequence
>MCA_01320_1 MSQFVGRTALSHARIWHHIDMAKETRTLGRVATAIALTLMGKHKPTYNQAVDGGDYVVVSNCHYLNVTGNKMEQKMYRRH SNRPGNLHEVKMADVLANKGGGEILRQAVSKMLPKNRLRKFRLDRLKTFEDSTNPYADNIIAYHDEAPQVAELLKAVKKS
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome