Protein
MCA_01299_1
Length
67 amino acids
Gene name: COX7
Description: Cytochrome c oxidase subunit 7
Browser: contigA:4079672-4080017-
RNA-seq: read pairs 34775, FPKM 6318.8, percentile rank 99.8% (100% = highest expression)
Protein function
Annotation: | COX7 | Cytochrome c oxidase subunit 7 | |
---|---|---|---|
EGGNOG: | 0PRYJ | COX7 | Inherit from euNOG: cytochrome C oxidase |
SGD closest match: | S000004869 | COX7 | Cytochrome c oxidase subunit 7 |
CGD closest match: | CAL0000194782 | COX7 | Cytochrome c oxidase subunit VII |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XEZ3_GEOCN | 71.19% | 59 | 6e-27 | Similar to Saccharomyces cerevisiae YMR256C COX7 Subunit VII of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA13s00637g PE=4 SV=1 |
A0A060T488_BLAAD | 66.67% | 60 | 3e-26 | ARAD1C42768p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42768g PE=4 SV=1 |
A0A1E3PFK4_9ASCO | 63.16% | 57 | 3e-22 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52525 PE=4 SV=1 |
UniRef50_A3LZV7 | 56.90% | 58 | 4e-12 | Cytochrome c oxidase polypeptide VII n=30 Tax=Saccharomycetales TaxID=4892 RepID=A3LZV7_PICST |
B5FVH7_YARLI | 52.83% | 53 | 1e-13 | YALI0E12628p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E12628g PE=4 SV=1 |
A0A1D8PJG0_CANAL | 53.57% | 56 | 2e-12 | Cytochrome c oxidase subunit VII OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX7 PE=4 SV=1 |
COX7_YEAST | 49.15% | 59 | 2e-12 | Cytochrome c oxidase subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX7 PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1128
Protein family membership
- Cytochrome c oxidase, subunit VIIa (IPR003177)
Domains and repeats
None predicted.
Detailed signature matches
-
-
SSF81419 (Mitochond...)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
PF02238 (COX7a)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01299_1 MVGFQIPKNHVIDYQKFYQANASTPLWLRHPRSKFIVYPFYALFTVTCVVVPTYYLGRAILGKKERD
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
GO:0009055 electron carrier activity
Cellular Component
GO:0005746 mitochondrial respiratory chain