Protein

MCA_01299_1

Length
67 amino acids

Gene name: COX7

Description: Cytochrome c oxidase subunit 7

Browser: contigA:4079672-4080017-

RNA-seq: read pairs 34775, FPKM 6318.8, percentile rank 99.8% (100% = highest expression)

Protein function

Annotation:COX7Cytochrome c oxidase subunit 7
EGGNOG:0PRYJCOX7Inherit from euNOG: cytochrome C oxidase
SGD closest match:S000004869COX7Cytochrome c oxidase subunit 7
CGD closest match:CAL0000194782COX7Cytochrome c oxidase subunit VII

Protein alignments

%idAln lengthE-value
A0A0J9XEZ3_GEOCN71.19%596e-27Similar to Saccharomyces cerevisiae YMR256C COX7 Subunit VII of cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA13s00637g PE=4 SV=1
A0A060T488_BLAAD66.67%603e-26ARAD1C42768p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42768g PE=4 SV=1
A0A1E3PFK4_9ASCO63.16%573e-22Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52525 PE=4 SV=1
UniRef50_A3LZV756.90%584e-12Cytochrome c oxidase polypeptide VII n=30 Tax=Saccharomycetales TaxID=4892 RepID=A3LZV7_PICST
B5FVH7_YARLI52.83%531e-13YALI0E12628p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E12628g PE=4 SV=1
A0A1D8PJG0_CANAL53.57%562e-12Cytochrome c oxidase subunit VII OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX7 PE=4 SV=1
COX7_YEAST49.15%592e-12Cytochrome c oxidase subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX7 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1128

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR003177
    Cytochrome c oxidase, subunit VIIa
    1. SSF81419 (Mitochond...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:4.10.91.10
  3. NON_CYTOPLASM... (N...)
  4. PD052427
  5. PF02238 (COX7a)
  6. TMhelix
  7. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_01299_1
MVGFQIPKNHVIDYQKFYQANASTPLWLRHPRSKFIVYPFYALFTVTCVVVPTYYLGRAILGKKERD

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004129 cytochrome-c oxidase activity
GO:0009055 electron carrier activity

Cellular Component

GO:0005746 mitochondrial respiratory chain