MCA_01253_1
Browser: contigA:3948760-3950368+
RNA-seq: read pairs 31, FPKM 0.7, percentile rank 8.0% (100% = highest expression)
Protein function
| EGGNOG: | 0PGYE | Cytochrome p450 | |
|---|---|---|---|
| SGD closest match: | S000002810 | DIT2 | Cytochrome P450-DIT2 |
| CGD closest match: | CAL0000200898 | CAALFM_CR00220WA | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05995_1 | 53.54% | 523 | 0.0 | MIA_05995_1 |
| A0A0J9YHJ2_GEOCN | 51.82% | 521 | 3e-180 | Similar to Saccharomyces cerevisiae YDR402C DIT2 N-formyltyrosine oxidase OS=Geotrichum candidum GN=BN980_GECA01s05323g PE=3 SV=1 |
| UniRef50_A0A0J9YHJ2 | 51.82% | 521 | 7e-177 | Similar to Saccharomyces cerevisiae YDR402C DIT2 N-formyltyrosine oxidase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YHJ2_GEOCN |
| A0A161HH99_9ASCO | 50.66% | 454 | 2e-146 | C-22 sterol desaturase OS=Sugiyamaella lignohabitans GN=ERG5 PE=3 SV=1 |
| A0A060T8H8_BLAAD | 44.89% | 548 | 1e-140 | ARAD1D06842p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D06842g PE=3 SV=1 |
| F2Z6J3_YARLI | 44.06% | 547 | 2e-137 | YALI0F01320p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F01320g PE=3 SV=1 |
| A0A1D8PRP5_CANAL | 47.47% | 455 | 2e-130 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR00220WA PE=3 SV=1 |
| A0A1E3PCY6_9ASCO | 39.29% | 397 | 7e-72 | Cytochrome P450 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72057 PE=3 SV=1 |
| A0A1E4TM94_9ASCO | 24.50% | 404 | 4e-25 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30882 PE=4 SV=1 |
| CP56_YEAST | 24.08% | 490 | 5e-14 | Cytochrome P450-DIT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT2 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8251
Predicted cleavage: 69
Protein family membership
- Cytochrome P450 (IPR001128)
- Cytochrome P450, E-class, group II (IPR002402)
- Cytochrome P450, E-class, CYP52 (IPR002974)
- Cytochrome P450, E-class, group II (IPR002402)
Domains and repeats
Detailed signature matches
no IPR
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_01253_1 MLLLYIAFPLVLILFYISIFPYIQHLNYLLNTWRKKGKEGVNLGIPKTVFSFPFGIPVFLGLVKSVRSRTLFDYLRVRNM KADYKLTVREQMLGQFNITTQDPENIKALLSTQFKEFGFGRRYQAFYPLLGDGIFTLDGVGWKHSRAMLRPQFTREQISH MGTLETHMKKMLNILRGHETTPVDIQKLFFKLTIDTATEFLFGESVGSFDGGNPKIKNSHSFDVSFNKSLSYLADRVRAN AFYNLFNSKEFHSWCKVCKDFTDSFVNLAIEKYEAQQRLGIDEKSITQLEKNTDKKKYVFLDELVKETRNPNVLRDQSLN ILLAGRDTTASVLSWIFYSLAHHKDVFFKLRKIILDEFGTGDNSSPENSLDRITFESLKKCVYLRHVINETLRLYPVVPN NIRTALVDTTLPRGGGENEDKPIFVPKGTGVGYSVLLMQTNPLIWGPDASEFKPERWETQRNSNVLYTHPWDFLPFNGGP RICLGQQFALNEMSYAIVRILQNFQDIQPAISSVHLEAQLTLSVFEGVPVTLTPA
GO term prediction
Biological Process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004497 monooxygenase activity
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0020037 heme binding
Cellular Component
None predicted.