Protein
MCA_01237_1
Length
158 amino acids
Gene name: GIM5
Description: Prefoldin subunit 5
Browser: contigA:3887041-3887585+
RNA-seq: read pairs 889, FPKM 69.1, percentile rank 72.3% (100% = highest expression)
Protein function
Annotation: | GIM5 | Prefoldin subunit 5 | |
---|---|---|---|
KEGG: | K04797 | pfdA | prefoldin alpha subunit |
EGGNOG: | 0PR1N | GIM5 | prefoldin subunit 5 |
SGD closest match: | S000004559 | GIM5 | Prefoldin subunit 5 |
CGD closest match: | CAL0000194812 | GIM5 | Gim5p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XG68_GEOCN | 53.85% | 130 | 2e-45 | Similar to Saccharomyces cerevisiae YML094W GIM5 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin OS=Geotrichum candidum GN=BN980_GECA14s01968g PE=3 SV=1 |
UniRef50_A0A0J9XG68 | 53.85% | 130 | 4e-42 | Similar to Saccharomyces cerevisiae YML094W GIM5 Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XG68_GEOCN |
A0A1E3PSM9_9ASCO | 52.80% | 125 | 5e-43 | Prefoldin alpha subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39658 PE=4 SV=1 |
A0A060T2M3_BLAAD | 50.00% | 110 | 5e-36 | ARAD1C33638p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33638g PE=4 SV=1 |
MIA_01950_1 | 45.45% | 121 | 1e-31 | MIA_01950_1 |
Q6C7S5_YARLI | 39.66% | 116 | 8e-28 | YALI0D25740p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D25740g PE=4 SV=1 |
PFD5_YEAST | 45.63% | 103 | 5e-27 | Prefoldin subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM5 PE=1 SV=1 |
Q5AA13_CANAL | 37.93% | 116 | 1e-22 | Gim5p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIM5 PE=4 SV=1 |
A0A1E4TAR5_9ASCO | 37.70% | 122 | 3e-22 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32320 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0331
Protein family membership
- Prefoldin alpha-like (IPR004127)
- Prefoldin alpha subunit, archaea-type (IPR011599)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02996 (Prefoldin)
-
![Unintegrated signatures Unintegrated signatures](resources/images/ico_type_uni_small.png)
Unintegrated signatures
Residue annotation
-
prefoldin alpha/be...
Protein sequence
>MCA_01237_1 MDSSAPSMNINDLTIPQLQQTQETLQSEIDHLTGSFEKIRQIQLKFQEAGKIIKEVSEGAKDGQDLLVPLTSSLYVPGKI MDKSKFLVDIGTGYFVEKNSENGQAFFKSKTTKLDQNLTDLEKIVTEKSQNLRVVQEVLKSKLQAAQASNPRPNAPAK
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
GO:0051082 unfolded protein binding
Cellular Component
GO:0016272 prefoldin complex