Protein

MCA_01219_1

Length
150 amino acids


Browser: contigA:3847861-3848798-

RNA-seq: read pairs 36212, FPKM 2963.2, percentile rank 98.4% (100% = highest expression)

Protein function

KEGG:K02966RP-S19e small subunit ribosomal protein S19e
EGGNOG:0PMW7RPS1940S ribosomal protein S19
SGD closest match:S000005481RPS19A40S ribosomal protein S19-A
CGD closest match:CAL0000200926RPS19ARibosomal 40S subunit protein S19A

Protein alignments

%idAln lengthE-value
MIA_00332_181.88%1496e-89MIA_00332_1
A0A060TD68_BLAAD71.33%1503e-77ARAD1D40502p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40502g PE=4 SV=1
Q6CDX3_YARLI71.33%1507e-77YALI0B20504p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B20504g PE=4 SV=1
UniRef50_Q6CDX371.33%1502e-73YALI0B20504p n=110 Tax=Opisthokonta TaxID=33154 RepID=Q6CDX3_YARLI
A0A0J9XAP1_GEOCN68.67%1502e-75Similar to Saccharomyces cerevisiae YOL121C RP55A Protein component of the small (40S) ribosomal subuni OS=Geotrichum candidum GN=BN980_GECA08s00846g PE=4 SV=1
A0A1E3PMP2_9ASCO68.67%1501e-73Ribosomal protein S19e OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_65241 PE=4 SV=1
A0A1E4TKI7_9ASCO70.59%1361e-71Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_84222 PE=4 SV=1
RS19A_YEAST73.53%1369e-7140S ribosomal protein S19-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS19A PE=1 SV=2
A0A1D8PK61_CANAL72.06%1362e-69Ribosomal 40S subunit protein S19A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS19A PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1008

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 150

Detailed signature matches

    1. SM01413 (Ribosomal_...)
    2. PF01090 (Ribosomal_...)
    1. SSF46785 ("Winged h...)
    1. PS00628 (RIBOSOMAL_...)

Protein sequence

>MCA_01219_1
MPSVNVRDVPAQEFIQSYATFLQRQGKLEIPGYVEIVKTGSGKELPPQDAEGWFYMRTASIARHVYLHKDVGVGALRKKF
GGAVNRGSCPSHHRDASASINRKALQGLEKLGIVEISKKGGRRITENGQRDLDRIALDLHNKLYEDSDDE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome