Protein

MCA_01206_1

Length
311 amino acids


Gene name: YML6

Description: 54S ribosomal protein YmL6, mitochondrial

Browser: contigA:3818540-3819553+

RNA-seq: read pairs 5024, FPKM 199.0, percentile rank 88.0% (100% = highest expression)

Protein function

Annotation:YML654S ribosomal protein YmL6, mitochondrial
KEGG:K02926RP-L4 large subunit ribosomal protein L4
EGGNOG:0PNBGYML6mitochondrial 54S ribosomal protein YmL6
SGD closest match:S000004487YML654S ribosomal protein YmL6, mitochondrial
CGD closest match:CAL0000188564YML6Mitochondrial 54S ribosomal protein YmL6

Protein alignments

%idAln lengthE-value
MIA_00515_160.79%2781e-119MIA_00515_1
A0A0J9XLD6_GEOCN57.84%2871e-107Similar to Saccharomyces cerevisiae YML025C YML6 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA32s01594g PE=4 SV=1
A0A060T7C7_BLAAD49.63%2729e-80ARAD1B22638p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B22638g PE=4 SV=1
UniRef50_A0A1E3QVS146.21%2773e-69Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QVS1_9ASCO
A0A161HJX4_9ASCO44.98%2692e-71Mitochondrial 54S ribosomal protein YmL6 OS=Sugiyamaella lignohabitans GN=YML6 PE=4 SV=1
RL4P_YEAST40.30%2631e-5554S ribosomal protein YmL6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML6 PE=1 SV=1
A0A1E3PJ40_9ASCO39.51%2866e-56Ribosomal protein L4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47013 PE=4 SV=1
A0A1E4TDG2_9ASCO50.61%1644e-50Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32906 PE=4 SV=1
Q6C573_YARLI39.10%2663e-49YALI0E20493p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E20493g PE=4 SV=1
A0A1D8PQQ9_CANAL35.88%2624e-47Mitochondrial 54S ribosomal protein YmL6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YML6 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9665
Predicted cleavage: 26

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 311

Detailed signature matches

    1. PF00573 (Ribosomal_L4)
    1. SSF52166 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_01206_1
MLRNTLLSLSRRVPSRSLATSCKPEMTLEKAASLVSSRVAEPPKYLLASARSFPDLEPQTVFPVSTVLLGEPLRRDILWR
AVVFEADASRVGSSNTRSRAEMGYSNKKLRPQKGSGKARMGSRGSPTRHDGGRAFARHAPFDWSTDLPRQIYFKAIRVAL
SHIYRQGRLFVLDDGVQADFVTSHSFAGKLFVAAHGKKQLPTDLSEFEELPKDEFTETERERLAKRKASIAKVKKNTDTA
DLGNVLVIPTEFRENLHEATAEKFGTKIEIIPAEAIEVRDLLKAHTVIVEKEALKFLGETFQPDEPIPTVC

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome