Protein
MCA_01187_2
Length
176 amino acids
Gene name: ARC18
Description: Actin-related protein 2/3 complex subunit 3
Browser: contigA:3760410-3761030-
RNA-seq: read pairs 3987, FPKM 278.3, percentile rank 91.3% (100% = highest expression)
Protein function
| Annotation: | ARC18 | Actin-related protein 2/3 complex subunit 3 | |
|---|---|---|---|
| KEGG: | K05756 | ARPC3 | actin related protein 2/3 complex, subunit 3 |
| EGGNOG: | 0PNX6 | ARC18 | arp2 3 complex |
| SGD closest match: | S000004362 | ARC18 | Actin-related protein 2/3 complex subunit 3 |
| CGD closest match: | CAL0000196412 | ARC18 | Actin-related protein 2/3 complex subunit 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XA07_GEOCN | 85.23% | 176 | 1e-110 | Actin-related protein 2/3 complex subunit 3 OS=Geotrichum candidum GN=BN980_GECA05s04410g PE=3 SV=1 |
| MIA_04907_1 | 87.20% | 164 | 4e-104 | MIA_04907_1 |
| A0A060T1J2_BLAAD | 75.43% | 175 | 1e-99 | Actin-related protein 2/3 complex subunit 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C21054g PE=3 SV=1 |
| A0A1E3PJ41_9ASCO | 75.71% | 177 | 9e-99 | Actin-related protein 2/3 complex subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52035 PE=3 SV=1 |
| Q6CDY5_YARLI | 74.29% | 175 | 1e-95 | Actin-related protein 2/3 complex subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B20240g PE=3 SV=1 |
| A0A1E4TDP2_9ASCO | 64.00% | 175 | 1e-82 | Actin-related protein 2/3 complex subunit 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1620 PE=3 SV=1 |
| ARPC3_YEAST | 63.48% | 178 | 1e-79 | Actin-related protein 2/3 complex subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC18 PE=1 SV=1 |
| Q59WT0_CANAL | 60.44% | 182 | 3e-74 | Actin-related protein 2/3 complex subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC18 PE=3 SV=1 |
| UniRef50_Q59WT0 | 60.44% | 182 | 8e-71 | Actin-related protein 2/3 complex subunit 3 n=174 Tax=Fungi TaxID=4751 RepID=Q59WT0_CANAL |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1165
Protein family membership
- Actin-related protein 2/3 complex subunit 3 (IPR007204)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF016315 (p21-ARC)
-
-
SSF69060 (Arp2/3 co...)
-
PF04062 (P21-Arc)
-
Protein sequence
>MCA_01187_2 MPAYHSTFLADGSDDRIVGNFAVLPLKTKFRGPAYPCNTDYDILDEVLDLFRANSFFRNFEIKGPADRTLIYGILFISDC LNKLKPDTNPTDANKILNTLAVEHFSIPGDPTFPLNALYAPPRDRQEADFLRSYLTQFRQELALRLIERIYPNGEKVPNK YWLAFTRRKFMNKSLS
GO term prediction
Biological Process
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation
Molecular Function
None predicted.
Cellular Component
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex