Protein

MCA_01177_1

Length
334 amino acids

Gene name: SCO1

Description: Protein SCO1, mitochondrial; Copper-binding protein of mitochondrial inner membrane

Browser: contigA:3714783-3715788+

RNA-seq: read pairs 6559, FPKM 241.9, percentile rank 90.2% (100% = highest expression)

Protein function

Annotation:SCO1Protein SCO1, mitochondrial; Copper-binding protein of mitochondrial inner membrane
KEGG:K07152SCO1_2 protein SCO1/2
EGGNOG:0PG4GSCO1mitochondrial
SGD closest match:S000000241SCO1Protein SCO1, mitochondrial
CGD closest match:CAL0000179863SCO1Cu-binding protein

Protein alignments

%idAln lengthE-value
MIA_00056_174.47%2821e-157MIA_00056_1
A0A0J9X815_GEOCN72.30%2782e-142Similar to Saccharomyces cerevisiae YBR037C SCO1 Copper-binding protein of the mitochondrial inner membrane,required for cytochrome c oxidase activity and respiration OS=Geotrichum candidum GN=BN980_GECA05s00593g PE=4 SV=1
A0A060T429_BLAAD60.93%2791e-117ARAD1C45342p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C45342g PE=4 SV=1
A0A1E3PCY2_9ASCO64.20%2575e-116SCO1 protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84439 PE=4 SV=1
A0A167DGD1_9ASCO55.25%2952e-110Sco1p OS=Sugiyamaella lignohabitans GN=SCO1 PE=4 SV=1
UniRef50_A0A167DGD155.25%2954e-107Sco1p n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A167DGD1_9ASCO
Q6C4X1_YARLI55.47%2473e-94YALI0E23045p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23045g PE=4 SV=1
SCO1_YEAST53.85%2477e-89Protein SCO1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCO1 PE=1 SV=1
A0A1E4TLM1_9ASCO50.21%2412e-84Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1246 PE=4 SV=1
A0A1D8PTX2_CANAL45.85%2532e-77Cu-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCO1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9919
Predicted cleavage: 41

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 334

Detailed signature matches

  1. Family IPR003782
    Copper chaperone SCO1/SenC
    1. PF02630 (SCO1-SenC)
    2. cd02968 (SCO)
  2. Family IPR017276
    Synthesis of cytochrome c oxidase, Sco1/Sco2
    1. PIRSF037736 (SCO1)
  3. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:3.40.30.10
  3. NON_CYTOPLASM... (N...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)
  6. mobidb-lite (disord...)

Residue annotation

  1. Cu(I) binding site...

Protein sequence

>MCA_01177_1
MASRLIVRSPAATSLMRGFTTCLRSSPVSAYSSYKSVRYYSSEPPSNSTKDNSAEQKDEKAENLSRGVPDPGTARHGYDP
LKPRKPLSRIAIGRAFDGNKAEQQATVGFLNWKAAVIFIATGAGLVYWFRQEKARAELEKLEESNRGYGKPLVGGPFKLI
DQNGNEFTDKDLLGKYSLIYFGFSRCPDICPDELEKMAQMIDMINKDKEIVKPIFVTCDPYRDSPEVLKEYLSEFHPDII
GLTGSYDDIKAMCKAYRVYFSLPPNLDPTKHEYLVDHSIFFYFMDPEGKYLDVFGRQYTPETAVQKMKEHMDVWLPTEQR
EAKKRSFWGRIARG

GO term prediction

Biological Process

GO:0006825 copper ion transport
GO:0006878 cellular copper ion homeostasis
GO:0008535 respiratory chain complex IV assembly

Molecular Function

GO:0005507 copper ion binding

Cellular Component

GO:0005743 mitochondrial inner membrane