Protein

MCA_01171_1

Length
552 amino acids

Gene name: DBP2

Description: ATP-dependent RNA helicase DBP2

Browser: contigA:3701935-3704685+

RNA-seq: read pairs 11775, FPKM 263.1, percentile rank 90.9% (100% = highest expression)

Protein function

Annotation:DBP2ATP-dependent RNA helicase DBP2
KEGG:K12823DDX5 ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
EGGNOG:0PGKNDBP2ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing (By similarity)
SGD closest match:S000005056DBP2ATP-dependent RNA helicase DBP2
CGD closest match:CAL0000194603DBP2ATP-dependent RNA helicase DBP2

Protein alignments

%idAln lengthE-value
MIA_02942_191.34%4390.0MIA_02942_1
A0A0J9XFW1_GEOCN87.73%4400.0Similar to Saccharomyces cerevisiae YNL112W DBP2 Essential ATP-dependent RNA helicase of the DEAD-box protein family, involved in nonsense-mediated mRNA decay and rRNA processing OS=Geotrichum candidum GN=BN980_GECA14s00692g PE=3 SV=1
A0A060T2W9_BLAAD87.30%4410.0ARAD1C28336p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C28336g PE=3 SV=1
A0A1E3PRS7_9ASCO84.05%4390.0p-loop containing nucleoside triphosphate hydrolase protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45619 PE=3 SV=1
DBP2_YARLI84.60%4350.0ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1
UniRef50_Q6C4D484.60%4350.0ATP-dependent RNA helicase DBP2 n=4 Tax=Opisthokonta TaxID=33154 RepID=DBP2_YARLI
DBP2_CANAL75.87%4310.0ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2
DBP2_YEAST75.63%4350.0ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1
A0A167FNB4_9ASCO85.75%3720.0DEAD-box ATP-dependent RNA helicase DBP2 OS=Sugiyamaella lignohabitans GN=DBP2 PE=3 SV=1
A0A1E4TAV5_9ASCO70.51%4510.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28219 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0105

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 100 200 300 400 500 552

Detailed signature matches

  1. Domain IPR014014
    RNA helicase, DEAD-box type, Q motif
    1. PS51195 (Q_MOTIF)
  2. Domain IPR014001
    Helicase superfamily 1/2, ATP-binding domain
    1. PS51192 (HELICASE_A...)
    2. SM00487 (ultradead3)
  3. Domain IPR011545
    DEAD/DEAH box helicase domain
    1. PF00270 (DEAD)
  4. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  5. Domain IPR001650
    Helicase, C-terminal
    1. PS51194 (HELICASE_CTER)
    2. SM00490 (helicmild6)
    3. PF00271 (Helicase_C)
  6. SITE IPR000629
    ATP-dependent RNA helicase DEAD-box, conserved site
    1. PS00039 (DEAD_ATP_H...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. cd00079 (HELICc)
  4. cd00268 (DEADc)
  5. mobidb-lite (disord...)

Residue annotation

  1. ATP binding site c...
  2. Mg++ binding site ...
  3. motif III cd00268
  4. nucleotide binding...
  5. ATP-binding site c...

Protein sequence

>MCA_01171_1
MSYGDNKYESRNGGGRDRQDRYDRGNSNGYGGGRDRNDRYNRNDRRGGDRNDRFDNRNGGGDRMSNLGDSLTKQEWDLES
LPKFEKNFYKEAPSVTERSDAEVEEFRNSHSMTVKGKDIPKPVLTFDEAGFPGYVLQEVKAQGFDAPTAIQSQGWPMALS
GRDVIGIAATGSGKTLSYCLPAIVHINAQPLLSRGDGPIVLVLAPTRELAVQIQQECSKFGKSSSIRNTCVYGGVPRGQQ
IRDLARGVEICIATPGRLIDMLESGKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKDVQRLA
YDYLKDYIQVNVGSLELSASHNIKQIVEVVSEYEKRERMAKHLEKAMEDKETKCLIFTGTKRSADEITKFLRQEGWPALA
IHGDKAQNERDWVLNEFRTGKSPIMVATDVASRGIDVKGINYVINYDYPNNSEDYVHRIGRTGRAGSKGTAITLFTQENS
KQARDLLTILKEAKQEIDPKLMEMGRFSRGGNGNSRYGGGGRGYRGGKFGGGGNRRGGYSGSNNEPLKRSRF

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0005524 ATP binding

Cellular Component

None predicted.