Protein
MCA_01064_1
Length
265 amino acids
Browser: contigA:3386776-3387574+
RNA-seq: read pairs 241, FPKM 11.2, percentile rank 27.8% (100% = highest expression)
Protein function
KEGG: | K10669 | TRPT1 | 2'-phosphotransferase [EC:2.7.1.160] |
---|---|---|---|
EGGNOG: | 0PPA7 | FG06974.1 | tRNA 2'phosphotransferase |
SGD closest match: | S000005462 | TPT1 | tRNA 2'-phosphotransferase |
CGD closest match: | CAL0000187877 | TPT1 | tRNA 2'-phosphotransferase |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01683_1 | 48.41% | 252 | 1e-79 | MIA_01683_1 |
A0A0J9XDX3_GEOCN | 47.74% | 243 | 4e-73 | Similar to Saccharomyces cerevisiae YOL102C TPT1 tRNA 2'-phosphotransferase, catalyzes the final step in yeast tRNA splicing OS=Geotrichum candidum GN=BN980_GECA11s02925g PE=4 SV=1 |
UniRef50_A0A0J9XDX3 | 47.74% | 243 | 9e-70 | Similar to Saccharomyces cerevisiae YOL102C TPT1 tRNA 2'-phosphotransferase, catalyzes the final step in yeast tRNA splicing n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XDX3_GEOCN |
A0A1E3PU66_9ASCO | 46.03% | 252 | 3e-63 | tRNA 2'-phosphotransferase 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49141 PE=4 SV=1 |
A0A060T3L1_BLAAD | 44.44% | 252 | 3e-59 | ARAD1A10604p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A10604g PE=4 SV=1 |
A0A167DSE2_9ASCO | 44.86% | 243 | 5e-57 | Tpt1p OS=Sugiyamaella lignohabitans GN=TPT1 PE=4 SV=1 |
Q6CDD9_YARLI | 37.74% | 265 | 8e-49 | YALI0C01287p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C01287g PE=4 SV=1 |
Q5A7N4_CANAL | 35.54% | 242 | 2e-35 | tRNA 2'-phosphotransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPT1 PE=4 SV=1 |
TPT1_YEAST | 32.66% | 248 | 4e-32 | tRNA 2'-phosphotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPT1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5385
Predicted cleavage: 25
Protein family membership
- Phosphotransferase KptA/Tpt1 (IPR002745)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01885 (PTS_2-RNA)
-
no IPR
Unintegrated signatures
-
SSF56399 (ADP-ribos...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_01064_1 MARGRAPLTPDVKLSKALSYILRHGAEKERIPIRSDGYICLKDLYKSSRVNNYSLQDIKRVVNNNDKKRFKLVHVPPGVD PASVLRKEEDEQHDGNETGNVSSSSSPEQQQQEETDTELKNWYIRANQGHSLSTVEVNLQPLKQISDFPNISTDGTPIVI HGTNWKAWQQIKQSGYLSRMNRTHIHMAPGRFGEDSVVSGMRASANVFIYIDIAKALESGIEFYKSENLVILSKGDSDGR IPIKFFSKVEVRQRDGTITLESLSL
GO term prediction
Biological Process
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation
Molecular Function
GO:0016772 transferase activity, transferring phosphorus-containing groups
Cellular Component
None predicted.