Protein

MCA_01035_1

Length
142 amino acids


Description: protein with Homeobox domain-like and DNA-binding HTH (Psq-type and CenpB-type) domains

Browser: contigA:3288793-3289222+

RNA-seq: read pairs 45, FPKM 3.9, percentile rank 15.6% (100% = highest expression)

Protein function

Annotation:protein with Homeobox domain-like and DNA-binding HTH (Psq-type and CenpB-type) domains
CGD closest match:CAL0000175723orf19.2866Uncharacterized protein

Protein alignments

%idAln lengthE-value
UniRef50_J4VY9330.30%1322e-11Transposase-like protein n=2 Tax=Beauveria bassiana TaxID=176275 RepID=J4VY93_BEAB2
A0A1D8PMN0_CANAL28.07%1149e-11Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2866 PE=4 SV=1
MIA_01984_132.74%1133e-09MIA_01984_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2530

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 142

Detailed signature matches

    1. SSF46689 (Homeodoma...)
    1. PF05225 (HTH_psq)
    1. SM00674 (cenpb)
    2. PF03221 (HTH_Tnp_Tc5)
    3. PS51253 (HTH_CENPB)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_01035_1
MVNEESITRAFDAVVRDKMSTRDAAIKFNVSRSTLRRRLQNGNKTMVSGHEHQMLLTLLEEDMVVCWIVNEDSMGHTPTD
EEIIQEARRIARFHKKDINPGKRWAYHFRRRHPLLKSIMVKRIEQARAKARTVNADSLYHNM

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding

Cellular Component

None predicted.