Protein
MCA_01008_1
Length
256 amino acids
Gene name: RPS1
Description: 40S ribosomal protein S1
Browser: contigA:3208417-3209188+
RNA-seq: read pairs 103156, FPKM 4959.5, percentile rank 99.6% (100% = highest expression)
Protein function
| Annotation: | RPS1 | 40S ribosomal protein S1 | |
|---|---|---|---|
| KEGG: | K02984 | RP-S3Ae | small subunit ribosomal protein S3Ae |
| EGGNOG: | 0PGZY | RPS1 | 40S ribosomal protein S1 |
| SGD closest match: | S000004433 | RPS1A | 40S ribosomal protein S1-A |
| CGD closest match: | CAL0000192592 | RPS1 | 40S ribosomal protein S1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01535_1 | 89.45% | 237 | 7e-159 | MIA_01535_1 |
| A0A0J9X704_GEOCN | 83.61% | 238 | 2e-148 | 40S ribosomal protein S1 OS=Geotrichum candidum GN=RPS1 PE=3 SV=1 |
| A0A167F938_9ASCO | 81.51% | 238 | 7e-144 | 40S ribosomal protein S1 OS=Sugiyamaella lignohabitans GN=RPS1A PE=3 SV=1 |
| A0A060TDQ9_BLAAD | 81.51% | 238 | 4e-143 | 40S ribosomal protein S1 OS=Blastobotrys adeninivorans GN=RPS1 PE=3 SV=1 |
| RS3A_YARLI | 75.53% | 237 | 1e-134 | 40S ribosomal protein S1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS1 PE=3 SV=2 |
| A0A1E3PI06_9ASCO | 74.48% | 239 | 2e-133 | 40S ribosomal protein S1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=RPS1 PE=3 SV=1 |
| RS3A_CANAL | 73.42% | 237 | 1e-131 | 40S ribosomal protein S1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS1 PE=3 SV=3 |
| A0A1E4TLC5_9ASCO | 74.15% | 236 | 1e-131 | 40S ribosomal protein S1 OS=Tortispora caseinolytica NRRL Y-17796 GN=RPS1 PE=3 SV=1 |
| UniRef50_J4W087 | 73.84% | 237 | 4e-127 | 40S ribosomal protein S1 n=4 Tax=Hypocreomycetidae TaxID=222543 RepID=J4W087_BEAB2 |
| RS3A1_YEAST | 71.73% | 237 | 6e-127 | 40S ribosomal protein S1-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS1A PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3629
Protein family membership
- Ribosomal protein S3Ae (IPR001593)
- 40S ribosomal protein S1/3, eukaryotes (IPR027500)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_03122 (Ribosomal...)
-
Protein sequence
>MCA_01008_1 MVVGKNKRLSKGKKGMKKKVIDPFSRKEWYNIKAPSPFEKRDVGKTLVNRSTGLKNANDELKGRIVDVSLADLQGQEDHA FRRIQLRVDEVQGKNLLTNFHGLDFASDKLRSFVRKWQTLIETNVTVKTSDDYYIRIFAIAFTKRAANQTKRTCYAQSSQ IRAIRKKMNEIIYKEAANVTLANLVSKIIPEVIGREIESSTRNIFPLQNVHIRKIKLLKQPKFDLGALLQLHGESLKDDS GKKVTSEFKEVVLESV
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome