Protein
MCA_00994_1
Length
77 amino acids
Browser: contigA:3159060-3159452-
RNA-seq: read pairs 7062, FPKM 1118.7, percentile rank 96.8% (100% = highest expression)
Protein function
| EGGNOG: | 0PT6G | FG00190.1 | NA |
|---|---|---|---|
| CGD closest match: | CAL0000199629 | orf19.3366.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06190_1 | 71.43% | 77 | 4e-37 | MIA_06190_1 |
| A0A0J9XA66_GEOCN | 69.74% | 76 | 2e-35 | NI9M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA06s05081g PE=4 SV=1 |
| A0A060SZT2_BLAAD | 65.75% | 73 | 5e-30 | ARAD1C11022p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11022g PE=4 SV=1 |
| UniRef50_A0A060SZT2 | 65.75% | 73 | 1e-26 | ARAD1C11022p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SZT2_BLAAD |
| B5FVF3_YARLI | 56.58% | 76 | 8e-28 | YALI0E23749p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23749g PE=4 SV=1 |
| A0A1D8PLS9_CANAL | 56.00% | 75 | 3e-25 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3366.1 PE=4 SV=1 |
| A0A1E4TMA6_9ASCO | 51.32% | 76 | 5e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_94786 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0880
Predicted cleavage: 17
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_00994_1 MVKPDFWKQPIRYLRYCSHEEPTLFFAVIIGVSGPVLALTMTPLRRKFLFPDAPAIPLTYPIPNRPRDKSLTGYDDE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.