Protein

MCA_00993_1

Length
300 amino acids


Gene name: MRPL22

Description: 54S ribosomal protein L22, mitochondrial

Browser: contigA:3157703-3158705+

RNA-seq: read pairs 3506, FPKM 143.9, percentile rank 84.4% (100% = highest expression)

Protein function

Annotation:MRPL2254S ribosomal protein L22, mitochondrial
EGGNOG:0PNW5MRPL22Ribosomal protein
SGD closest match:S000005121MRPL2254S ribosomal protein L22, mitochondrial
CGD closest match:CAL0000174039orf19.3367Mitochondrial 54S ribosomal protein YmL22

Protein alignments

%idAln lengthE-value
MIA_06188_154.78%3143e-114MIA_06188_1
A0A0J9X9N0_GEOCN56.44%2642e-102Similar to Saccharomyces cerevisiae YNL177C MRPL22 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA06s05070g PE=3 SV=1
UniRef50_A0A0J9X9N056.44%2644e-99Similar to Saccharomyces cerevisiae YNL177C MRPL22 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9N0_GEOCN
A0A167CIF6_9ASCO44.55%3123e-74Mitochondrial 54S ribosomal protein YmL22 OS=Sugiyamaella lignohabitans GN=MRPL22 PE=3 SV=1
A0A060T5C7_BLAAD44.94%2677e-63ARAD1C11044p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C11044g PE=3 SV=1
A0A1E3PLN6_9ASCO40.15%2743e-58Ribosomal protein L22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82965 PE=3 SV=1
RM22_YEAST38.75%2713e-4954S ribosomal protein L22, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL22 PE=1 SV=2
Q6C4T8_YARLI35.59%2951e-47YALI0E23760p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23760g PE=3 SV=1
A0A1D8PLT6_CANAL39.42%2088e-45Mitochondrial 54S ribosomal protein YmL22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3367 PE=3 SV=1
A0A1E4TJU0_9ASCO32.80%1863e-26Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_12407 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9915
Predicted cleavage: 38

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF00237 (Ribosomal_L22)
    2. SSF54843 (Ribosomal...)
    3. cd00336 (Ribosomal_L22)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. putative transloco...
  2. protein-rRNA inter...

Protein sequence

>MCA_00993_1
MAISSLSFGLKRLSLRTTTGLYSKAFARPFSSSLVSLKDNKEVSAQSESGSIFGSFTNKQASSYLDSNQVMENDDENKVD
YTKVDFSKDPAVIAFNNPGAESAVETLLSPLKQRLYQRALETGGYTKDKVIELDGKKYKLNLTEEELKYLVPSVYLHSVR
IKGSYKKGTVFTRLFRGMDLKKAITQCHFSRKRMATDVGKMLEKGVEHAKQLKLNPEDLYISQIWVGKEPYLMKRVDFKG
RGRSGIMEHPHIHIKAILQTKQHREELLQAKKERNLNKKVWEQHHSTPIKVYRGSSQYQW

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome