Protein
MCA_00980_1
Length
223 amino acids
Gene name: CBC2
Description: Nuclear cap-binding protein subunit 2
Browser: contigA:3119429-3120101+
RNA-seq: read pairs 1059, FPKM 58.4, percentile rank 68.7% (100% = highest expression)
Protein function
| Annotation: | CBC2 | Nuclear cap-binding protein subunit 2 | |
|---|---|---|---|
| KEGG: | K12883 | NCBP2 | nuclear cap-binding protein subunit 2 |
| EGGNOG: | 0PN15 | CBC2 | nuclear cap-binding protein subunit 2 |
| SGD closest match: | S000006099 | CBC2 | Nuclear cap-binding protein subunit 2 |
| CGD closest match: | CAL0000178064 | orf19.763 | Nuclear cap-binding protein subunit 2 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A060T9V8_BLAAD | 55.28% | 161 | 1e-60 | Nuclear cap-binding protein subunit 2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C40590g PE=3 SV=1 |
| A0A0J9X5X6_GEOCN | 50.54% | 184 | 2e-59 | Nuclear cap-binding protein subunit 2 OS=Geotrichum candidum GN=BN980_GECA04s00362g PE=3 SV=1 |
| Q6C468_YARLI | 51.72% | 174 | 2e-59 | Nuclear cap-binding protein subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E29293g PE=3 SV=2 |
| A0A167EVE7_9ASCO | 51.15% | 174 | 8e-59 | Nuclear cap-binding protein subunit 2 OS=Sugiyamaella lignohabitans GN=CBC2 PE=3 SV=1 |
| MIA_05343_1 | 53.70% | 162 | 2e-58 | MIA_05343_1 |
| UniRef50_J3P7J7 | 53.80% | 158 | 4e-54 | Nuclear cap-binding protein subunit 2 n=5 Tax=Eukaryota TaxID=2759 RepID=J3P7J7_GAGT3 |
| NCBP2_YEAST | 50.91% | 165 | 2e-55 | Nuclear cap-binding protein subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBC2 PE=1 SV=1 |
| A0A1E3PFM2_9ASCO | 49.72% | 179 | 2e-53 | Nuclear cap-binding protein subunit 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83769 PE=3 SV=1 |
| A0A1E4TCJ9_9ASCO | 51.55% | 161 | 2e-51 | Nuclear cap-binding protein subunit 2 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3995 PE=3 SV=1 |
| Q59VH0_CANAL | 50.00% | 156 | 2e-47 | Nuclear cap-binding protein subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.763 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2184
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
50
100
150
223
Detailed signature matches
-
-
cd12240 (RRM_NCBP2)
-
no IPR
Unintegrated signatures
Residue annotation
-
chemical substrate...
-
subunit interface ...
Protein sequence
>MCA_00980_1 MSGGSRDSYHRSNENLIVNPKFKELSEVPDNSLFTRYSKNSTRRLDNPSEYLINKAKRAYKQSDRRGEEKSSKAITDLQK AAESSTVYVGNLSFYTTEEQIYELFSKCGRIKRIIMGLNQKTQTPCGFCFVEFYTHQEAIHSIRYLKYTLLEGREISLDM DPGFEEGREYGRGISGGQVQDEFRTNYDAERGGYGRQYDMNVSLSSMAGMTMDYGFPMLNGPM
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0003676 nucleic acid binding
Cellular Component
None predicted.