Protein

MCA_00961_1

Length
72 amino acids


Browser: contigA:3045941-3046634+

RNA-seq: read pairs 6427, FPKM 1087.8, percentile rank 96.8% (100% = highest expression)

Protein function

CGD closest match:CAL0000201932orf19.216.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_01904_180.28%716e-37MIA_01904_1
A0A0J9XB57_GEOCN77.94%685e-32Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA08s00362g PE=4 SV=1
A0A060TDL7_BLAAD55.36%562e-16ARAD1D44924p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D44924g PE=4 SV=1
UniRef50_J4GHF865.22%468e-13Uncharacterized protein n=8 Tax=Basidiomycota TaxID=5204 RepID=J4GHF8_9APHY
A0A1D8PIC2_CANAL57.14%422e-11Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.216.1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6016
Predicted cleavage: 44

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_00961_1
MAGHGHYKPYGTLPFPHASRAHTFISKFLGATMWFWIFYRVREDGGVMLGLRHPWEHGSSHGHEIEDKKEEH

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

GO:0005743 mitochondrial inner membrane
GO:0005747 mitochondrial respiratory chain complex I