Protein

MCA_00934_1

Length
169 amino acids


Gene name: IMG1

Description: 54S ribosomal protein IMG1, mitochondrial

Browser: contigA:2945874-2946384-

RNA-seq: read pairs 2792, FPKM 202.9, percentile rank 88.3% (100% = highest expression)

Protein function

Annotation:IMG154S ribosomal protein IMG1, mitochondrial
EGGNOG:0PPRYFG07285.1mitochondrial 54S ribosomal protein IMG1
SGD closest match:S000000642IMG154S ribosomal protein IMG1, mitochondrial
CGD closest match:CAL0000175674orf19.1967Mitochondrial 54S ribosomal protein IMG1

Protein alignments

%idAln lengthE-value
MIA_02912_168.10%1631e-73MIA_02912_1
A0A0J9XAL2_GEOCN52.03%1485e-53Similar to Saccharomyces cerevisiae YCR046C IMG1 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA07s01011g PE=4 SV=1
UniRef50_A0A0J9XAL252.03%1481e-49Similar to Saccharomyces cerevisiae YCR046C IMG1 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XAL2_GEOCN
A0A060TBX7_BLAAD45.14%1448e-43ARAD1B18348p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B18348g PE=4 SV=1
A0A1E3PJZ2_9ASCO36.81%1446e-28Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46971 PE=4 SV=1
Q6C0I6_YARLI29.68%1552e-24YALI0F24365p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24365g PE=4 SV=1
A0A1E4TAZ4_9ASCO36.80%1256e-24Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13293 PE=4 SV=1
A0A1D8PN49_CANAL36.11%1441e-21Mitochondrial 54S ribosomal protein IMG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1967 PE=4 SV=1
IMG1_YEAST32.89%1526e-2054S ribosomal protein IMG1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMG1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9970
Predicted cleavage: 16

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 169

Detailed signature matches

    1. PF01245 (Ribosomal_L19)
    2. PR00061 (RIBOSOMALL19)
    1. SSF50104 (Translati...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_00934_1
MSLFSRVLTATFRSAASLAPKISTRSYQIPTKTSKSIKVYQPLPKLTPKKVNLVNSVEYSLIQKHDPTGWRTAFIKRDNP
KGFRPGDIIRVIKNDKTHFTGMLIAINRNGLSSSFLLRNKITGLGVETRYMIYSPIIKAIELIRRPVKPKRRAKLYYVRG
SAKHDVREL

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome