Protein
MCA_00913_1
Length
77 amino acids
Browser: contigA:2879346-2879580+
RNA-seq: read pairs 357, FPKM 56.6, percentile rank 68.0% (100% = highest expression)
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_06234_1 | 80.95% | 21 | 2e-06 | MIA_06234_1 |
A0A060T549_BLAAD | 76.19% | 21 | 2e-06 | ARAD1C03036p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C03036g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5711
Protein family membership
- Anaphase-promoting complex, subunit CDC26 (IPR018860)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10471 (ANAPC_CDC26)
-

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_00913_1 MLRRPPTQIQLTSEDVLAFDDRREKKRQEESEEEKNINENEGVKSEEAMKKGDDGINNDNNSNNKKKKGIEERIGLQ
GO term prediction
Biological Process
GO:0030071 regulation of mitotic metaphase/anaphase transition
GO:0031145 anaphase-promoting complex-dependent catabolic process
Molecular Function
None predicted.
Cellular Component
GO:0005680 anaphase-promoting complex