Protein
MCA_00906_1
Length
123 amino acids
Gene name: ISD11
Description: Cysteine desulfurase (Nfs1p) activator
Browser: contigA:2849048-2849420-
RNA-seq: read pairs 1556, FPKM 155.0, percentile rank 85.3% (100% = highest expression)
Protein function
| Annotation: | ISD11 | Cysteine desulfurase (Nfs1p) activator | |
|---|---|---|---|
| EGGNOG: | 0PPKQ | FG00264.1 | Iron-sulfur cluster biosynthesis protein Isd11 |
| SGD closest match: | S000007237 | ISD11 | Protein ISD11 |
| CGD closest match: | CAL0000176168 | orf19.1267.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02838_1 | 75.41% | 122 | 7e-62 | MIA_02838_1 |
| A0A0J9X7D5_GEOCN | 59.79% | 97 | 2e-32 | Similar to Saccharomyces cerevisiae YER048W-A ISD11 Cysteine desulfurase (Nfs1p) activator OS=Geotrichum candidum GN=BN980_GECA04s03882g PE=3 SV=1 |
| UniRef50_A0A0J9X7D5 | 59.79% | 97 | 4e-29 | Similar to Saccharomyces cerevisiae YER048W-A ISD11 Cysteine desulfurase (Nfs1p) activator n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X7D5_GEOCN |
| A0A060T5A5_BLAAD | 52.50% | 80 | 2e-25 | ARAD1C04026p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C04026g PE=3 SV=1 |
| Q6C9C7_YARLI | 56.10% | 82 | 5e-25 | YALI0D12254p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12254g PE=3 SV=1 |
| A0A1E3PL87_9ASCO | 53.75% | 80 | 3e-23 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82101 PE=3 SV=1 |
| A0A1E4TLP4_9ASCO | 50.00% | 80 | 3e-22 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22931 PE=3 SV=1 |
| ISD11_YEAST | 49.33% | 75 | 8e-19 | Protein ISD11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISD11 PE=1 SV=1 |
| A0A1D8PMF5_CANAL | 43.04% | 79 | 4e-17 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1267.1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9673
Predicted cleavage: 40
Protein family membership
- Complex 1 LYR protein (IPR008011)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05347 (Complex1_LYR)
-
Protein sequence
>MCA_00906_1 MSIPVAKVSAHTLAKDSLSLYRNLLRQGSRLASYNFREYALRRTRDAFRANQNIEDLREAQVLLQKGYKDLEMLKRQSTI SQMYTADKLVVEEYAPKNPIIASHEKFAIKPSSPELPEIVNEN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.