Protein
MCA_00875_1
Length
308 amino acids
Browser: contigA:2757608-2758586+
RNA-seq: read pairs 478, FPKM 19.1, percentile rank 40.2% (100% = highest expression)
Protein function
| KEGG: | K11376 | ELP5 | elongator complex protein 5 |
|---|---|---|---|
| EGGNOG: | 0PKXJ | PGUG_00059 | Killer toxin sensitivity protein |
| SGD closest match: | S000001230 | IKI1 | Elongator complex protein 5 |
| CGD closest match: | CAL0000180661 | orf19.2676 | Elongator subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XIQ4_GEOCN | 51.27% | 275 | 1e-86 | Similar to Saccharomyces cerevisiae YHR187W IKI1 Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA OS=Geotrichum candidum GN=BN980_GECA20s00703g PE=4 SV=1 |
| UniRef50_A0A0J9XIQ4 | 51.27% | 275 | 2e-83 | Similar to Saccharomyces cerevisiae YHR187W IKI1 Subunit of Elongator complex, which is required for modification of wobble nucleosides in tRNA n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIQ4_GEOCN |
| MIA_06081_1 | 46.82% | 299 | 7e-85 | MIA_06081_1 |
| A0A060T6U9_BLAAD | 43.86% | 285 | 3e-75 | ARAD1B15026p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B15026g PE=4 SV=1 |
| A0A1E3PG40_9ASCO | 40.00% | 270 | 4e-58 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83881 PE=4 SV=1 |
| W0TYP8_YARLI | 35.69% | 283 | 6e-52 | YALI0B09295p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B09295g PE=4 SV=1 |
| Q5AFD1_CANAL | 36.36% | 286 | 1e-50 | Elongator subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2676 PE=4 SV=1 |
| ELP5_YEAST | 33.22% | 283 | 2e-45 | Elongator complex protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI1 PE=1 SV=1 |
| A0A167DVN2_9ASCO | 46.72% | 137 | 2e-34 | Elongator subunit IKI1 OS=Sugiyamaella lignohabitans GN=IKI1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2774
Predicted cleavage: 26
Protein family membership
- Elongator complex protein 5 (IPR019519)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10483 (Elong_Iki1)
-
Protein sequence
>MCA_00875_1 MNSNQKHQQNTVLLPRLLGLRDHSPFILLVDTVAQSAQYLVQEIFHRIPSDANVIQLNFESIDIHPRVNKVIDGISVSNI DKLQQDVLASIRSDSKNVIFIDSMAYIHSETYSKFLLPMMSPTVSIIAVYHTDAPFSRSIFSKSPYFPAPASLLGYFATS IISIHPFDIQTEDDYTDNADTLQQVRQFVYPSNSNITKFLVHLIHRRKSGRSIEADYEISFETHTIQYKPEKKQKETSSG DGSEELLKGLTTFNLTTTENQRIAREKVDLPYLQAQEVGEGGAKGGAIIYEFEKDDDYDEEDPYEDPF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0033588 Elongator holoenzyme complex