Protein

MCA_00857_2

Length
92 amino acids


Gene name: RPL43

Description: 60S ribosomal protein L43-B

Browser: contigA:2682650-2683223-

RNA-seq: read pairs 32169, FPKM 4274.0, percentile rank 99.2% (100% = highest expression)

Protein function

Annotation:RPL4360S ribosomal protein L43-B
KEGG:K02921RP-L37Ae large subunit ribosomal protein L37Ae
EGGNOG:0PQ1GRPL4360S ribosomal protein L43
SGD closest match:S000003855RPL43B60S ribosomal protein L43-B
CGD closest match:CAL0000185522RPL43ARibosomal 60S subunit protein L43A

Protein alignments

%idAln lengthE-value
A0A0F7RSZ8_GEOCN79.12%912e-46Similar to Saccharomyces cerevisiae YJR094W-A RPL43B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA05s02364g PE=3 SV=1
A0A060TH74_BLAAD77.17%923e-45ARAD1D36520p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36520g PE=3 SV=1
A0A1E3PDX8_9ASCO74.73%913e-43Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_67639 PE=3 SV=1
Q6C3I3_YARLI73.91%921e-43YALI0E34573p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E34573g PE=3 SV=2
A0A1D8PP14_CANAL71.74%921e-41Ribosomal 60S subunit protein L43A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL43A PE=3 SV=1
MIA_00110_181.82%884e-41MIA_00110_1
A0A1E4TK24_9ASCO71.43%912e-41Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_55851 PE=3 SV=1
UniRef50_A0A151VTD367.39%921e-3660S ribosomal protein L37a n=32 Tax=Opisthokonta TaxID=33154 RepID=A0A151VTD3_HYPMA
RL43B_YEAST69.57%922e-3960S ribosomal protein L43-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL43B PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8838
Predicted cleavage: 97

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 92

Detailed signature matches

    1. MF_00327 (Ribosomal...)
    2. PF01780 (Ribosomal_...)
    1. SSF57829 (Zn-bindin...)

Protein sequence

>MCA_00857_2
MTKRTKKVGITGKYGVRYGSSLRRQCKKIETQQHSRYLCPFCGKTSIKRSATGIWNCGGCKKTIAGGAYSLTTAAATTAR
TNMKRLRDLAEA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome