Protein

MCA_00844_1

Length
122 amino acids

Description: Putative stress-responsive protein

Browser: contigA:2635478-2635947-

RNA-seq: read pairs 1124, FPKM 112.9, percentile rank 80.7% (100% = highest expression)

Protein function

Annotation:Putative stress-responsive protein

Protein alignments

%idAln lengthE-value

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1177
Predicted cleavage: 37

Protein family membership

None predicted.

Domains and repeats

  1. Repeat
1 20 40 60 80 100 122

Detailed signature matches

  1. Repeat IPR018803
    Putative stress-responsive protein
    1. PF10281 (Ish1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:1.10.72...
  3. NON_CYTOPLASM... (N...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)
  6. mobidb-lite (disord...)

Protein sequence

>MCA_00844_1
MVQTKLDKALKAYAKPLLWAFGSMVVAATAYTLTRGSGQPDQKGSGDDDWVYSYSASKEFQKSVKPSKSSDLKKKSNEEE
EQDLDFENWDEEKLRKWLEEKKYVTSPESATKEQLVSLAKSL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.