Protein

MCA_00779_1

Length
245 amino acids

Gene name: HAP5

Description: Transcriptional activator HAP5

Browser: contigA:2428433-2429171-

RNA-seq: read pairs 1601, FPKM 80.4, percentile rank 75.3% (100% = highest expression)

Protein function

Annotation:HAP5Transcriptional activator HAP5
EGGNOG:0PK7ZFG02608.1CCAAT-binding factor complex subunit
SGD closest match:S000005885HAP5Transcriptional activator HAP5
CGD closest match:CAL0000182721HAP5Transcriptional activator

Protein alignments

%idAln lengthE-value
MIA_01010_189.60%1253e-79MIA_01010_1
A0A0J9X881_GEOCN88.71%1243e-78Transcriptional activator OS=Geotrichum candidum GN=BN980_GECA05s01847g PE=3 SV=1
Q6CFV6_YARLI87.18%1174e-73Transcriptional activator OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B03322g PE=3 SV=1
A0A167FE48_9ASCO87.07%1167e-72Transcriptional activator OS=Sugiyamaella lignohabitans GN=HAP5 PE=3 SV=1
A0A1E3PLH9_9ASCO84.30%1212e-73Transcriptional activator (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24404 PE=3 SV=1
A0A060TII5_BLAAD84.87%1191e-70Transcriptional activator OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D38786g PE=3 SV=1
UniRef50_A0A1E4SRX282.05%1175e-65Transcriptional activator (Fragment) n=2 Tax=Fungi TaxID=4751 RepID=A0A1E4SRX2_9ASCO
A0A1D8PN26_CANAL81.74%1151e-65Transcriptional activator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAP5 PE=3 SV=1
HAP5_YEAST67.48%1232e-54Transcriptional activator HAP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP5 PE=1 SV=1
A0A1E4TF89_9ASCO76.67%601e-26Transcriptional activator OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31388 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0719

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 245

Detailed signature matches

  1. Domain IPR009072
    Histone-fold
    1. SSF47113 (Histone-fold)
  2. Domain IPR003958
    Transcription factor CBF/NF-Y/archaeal histone domain
    1. PF00808 (CBFD_NFYB_HMF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.20.10
  3. mobidb-lite (disord...)

Protein sequence

>MCA_00779_1
MNQEQQAAAEAAARAEAEALTEEQLAYEQMQDPNFTIGTFNNVAQGLTGHYRNTMLAYWQETINAIENNDHEFKIHQLPL
ARIKKVMKADEEVNMISAEAPILFAKGCDIFITELTMRAWIHAEENKRRTLQRSDIASALQKSDMFDFLIDIVPREEAML
SSSSAAARRAQQQAAAEAAAQAQAQAEAEGYEQYEGQEMVEGEEEEESETDQYQQQQQQQQQLEQLQQQQMLEENRIYGE
YRGYQ

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0046982 protein heterodimerization activity

Cellular Component

None predicted.