Protein
MCA_00714_1
Length
249 amino acids
Gene name: MRPL25
Description: 54S ribosomal protein L25, mitochondrial
Browser: contigA:2234908-2235658+
RNA-seq: read pairs 2895, FPKM 143.1, percentile rank 84.4% (100% = highest expression)
Protein function
| Annotation: | MRPL25 | 54S ribosomal protein L25, mitochondrial | |
|---|---|---|---|
| EGGNOG: | 0PNTI | MRPL25 | mitochondrial 54S ribosomal protein YmL25 |
| SGD closest match: | S000003308 | MRPL25 | 54S ribosomal protein L25, mitochondrial |
| CGD closest match: | CAL0000196882 | CAALFM_CR10830CA | Mitochondrial 54S ribosomal protein YmL25 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03278_1 | 64.00% | 250 | 5e-103 | MIA_03278_1 |
| A0A0J9X3M1_GEOCN | 48.59% | 249 | 2e-65 | Similar to Saccharomyces cerevisiae YGR076C MRPL25 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA01s10988g PE=4 SV=1 |
| UniRef50_A0A0J9X3M1 | 48.59% | 249 | 4e-62 | Similar to Saccharomyces cerevisiae YGR076C MRPL25 Mitochondrial ribosomal protein of the large subunit n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X3M1_GEOCN |
| A0A060TGG2_BLAAD | 57.32% | 157 | 1e-49 | ARAD1D30184p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D30184g PE=4 SV=1 |
| A0A161HGC5_9ASCO | 61.22% | 147 | 2e-49 | Mitochondrial 54S ribosomal protein YmL25 OS=Sugiyamaella lignohabitans GN=MRPL25 PE=4 SV=1 |
| RM25_YEAST | 38.89% | 162 | 6e-30 | 54S ribosomal protein L25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL25 PE=1 SV=2 |
| Q6C834_YARLI | 48.55% | 138 | 7e-29 | YALI0D23155p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23155g PE=4 SV=1 |
| A0A1E3PNE6_9ASCO | 56.70% | 97 | 9e-24 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_7300 PE=4 SV=1 |
| A0A1D8PUC5_CANAL | 38.22% | 157 | 3e-19 | Mitochondrial 54S ribosomal protein YmL25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR10830CA PE=4 SV=1 |
| A0A1E4TG56_9ASCO | 33.05% | 118 | 6e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2490 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7984
Predicted cleavage: 36
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_00714_1 MRTTRFLLHESHQVTATFVAPRLRQRLLSSEIQEAVEYIKTERVRHSQALEQYNKIYKSKDSEQASTEADTESLEIKSEE SSIPPPPEPTVPLTGNAFFATLPKPLADFFKRFPPPPFRTYATKPTTIDDPAANPFLPNKNPLNDKYHDPIYSLRRQSDL YKAAYRYGITHLLPPLQNDKKFYEEKYETKPPLRGATKFKLSIAERKAPARKAEMEEAIAKADEVIAKARGSRWRRKMEK KQKEPLPWF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.