Protein

MCA_00714_1

Length
249 amino acids


Gene name: MRPL25

Description: 54S ribosomal protein L25, mitochondrial

Browser: contigA:2234908-2235658+

RNA-seq: read pairs 2895, FPKM 143.1, percentile rank 84.4% (100% = highest expression)

Protein function

Annotation:MRPL2554S ribosomal protein L25, mitochondrial
EGGNOG:0PNTIMRPL25mitochondrial 54S ribosomal protein YmL25
SGD closest match:S000003308MRPL2554S ribosomal protein L25, mitochondrial
CGD closest match:CAL0000196882CAALFM_CR10830CAMitochondrial 54S ribosomal protein YmL25

Protein alignments

%idAln lengthE-value
MIA_03278_164.00%2505e-103MIA_03278_1
A0A0J9X3M1_GEOCN48.59%2492e-65Similar to Saccharomyces cerevisiae YGR076C MRPL25 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA01s10988g PE=4 SV=1
UniRef50_A0A0J9X3M148.59%2494e-62Similar to Saccharomyces cerevisiae YGR076C MRPL25 Mitochondrial ribosomal protein of the large subunit n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X3M1_GEOCN
A0A060TGG2_BLAAD57.32%1571e-49ARAD1D30184p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D30184g PE=4 SV=1
A0A161HGC5_9ASCO61.22%1472e-49Mitochondrial 54S ribosomal protein YmL25 OS=Sugiyamaella lignohabitans GN=MRPL25 PE=4 SV=1
RM25_YEAST38.89%1626e-3054S ribosomal protein L25, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL25 PE=1 SV=2
Q6C834_YARLI48.55%1387e-29YALI0D23155p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23155g PE=4 SV=1
A0A1E3PNE6_9ASCO56.70%979e-24Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_7300 PE=4 SV=1
A0A1D8PUC5_CANAL38.22%1573e-19Mitochondrial 54S ribosomal protein YmL25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR10830CA PE=4 SV=1
A0A1E4TG56_9ASCO33.05%1186e-12Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2490 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7984
Predicted cleavage: 36

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_00714_1
MRTTRFLLHESHQVTATFVAPRLRQRLLSSEIQEAVEYIKTERVRHSQALEQYNKIYKSKDSEQASTEADTESLEIKSEE
SSIPPPPEPTVPLTGNAFFATLPKPLADFFKRFPPPPFRTYATKPTTIDDPAANPFLPNKNPLNDKYHDPIYSLRRQSDL
YKAAYRYGITHLLPPLQNDKKFYEEKYETKPPLRGATKFKLSIAERKAPARKAEMEEAIAKADEVIAKARGSRWRRKMEK
KQKEPLPWF

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.