Protein
MCA_00694_1
Length
234 amino acids
Gene name: PEX11
Description: Peroxisomal membrane protein PMP27
Browser: contigA:2178168-2178975-
RNA-seq: read pairs 2212, FPKM 116.3, percentile rank 81.2% (100% = highest expression)
Protein function
| Annotation: | PEX11 | Peroxisomal membrane protein PMP27 | |
|---|---|---|---|
| EGGNOG: | 0PJZK | PEX11 | peroxisomal biogenesis factor |
| SGD closest match: | S000005507 | PEX11 | Peroxisomal membrane protein PMP27 |
| CGD closest match: | CAL0000200064 | PEX11 | Pex11p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01113_1 | 73.19% | 235 | 6e-127 | MIA_01113_1 |
| A0A0J9X8N3_GEOCN | 57.02% | 235 | 2e-84 | Similar to Saccharomyces cerevisiae YOL147C PEX11 Peroxisomal membrane protein required for medium-chain fatty acid oxidation and peroxisome proliferation OS=Geotrichum candidum GN=BN980_GECA05s07248g PE=4 SV=1 |
| A0A1E3PCJ6_9ASCO | 51.08% | 231 | 2e-80 | Peroxisomal biogenesis factor 11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48346 PE=4 SV=1 |
| UniRef50_A0A1E3PCJ6 | 51.08% | 231 | 7e-77 | Peroxisomal biogenesis factor 11 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3PCJ6_9ASCO |
| Q6CD37_YARLI | 46.58% | 234 | 1e-71 | YALI0C04092p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C04092g PE=4 SV=1 |
| A0A060TGW7_BLAAD | 46.72% | 229 | 4e-62 | ARAD1D34188p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34188g PE=4 SV=1 |
| A0A1D8PQD7_CANAL | 37.30% | 244 | 4e-48 | Pex11p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PEX11 PE=4 SV=1 |
| A0A1E4TKT1_9ASCO | 33.47% | 242 | 6e-35 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_22000 PE=4 SV=1 |
| PEX11_YEAST | 32.51% | 243 | 9e-34 | Peroxisomal membrane protein PMP27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX11 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0765
Protein family membership
- Peroxisomal biogenesis factor 11 (IPR008733)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_00694_1 MSLANHPTLTHLVTLLEKTTGRDKILRTIQYWSRFFAYVLYKKGFPKESILFWKNLQAQVALSRKLFRVGKPLNHFKLAG KAYANKTNDPILRTTSVLRNAFYTGYFTIDTIVWLNQAKVFQTPNFKKIQRLGSKLWLTGLVFNIINSLRRLQISSDKIS ALQAESEKDTSSIKRVRLEQKAAIHQLVWDLLDSTIPAYSLDLAPSWLLDDGIVGLAGLITAIFGLKQQWRLTA
GO term prediction
Biological Process
GO:0016559 peroxisome fission
Molecular Function
None predicted.
Cellular Component
GO:0005779 integral component of peroxisomal membrane