Protein
MCA_00659_2
Length
206 amino acids
Gene name: RPL13
Description: 60S ribosomal protein L13
Browser: contigA:2061973-2063038+
RNA-seq: read pairs 51669, FPKM 3084.2, percentile rank 98.5% (100% = highest expression)
Protein function
| Annotation: | RPL13 | 60S ribosomal protein L13 | |
|---|---|---|---|
| KEGG: | K02873 | RP-L13e | large subunit ribosomal protein L13e |
| EGGNOG: | 0PFGM | RPL13 | 60S ribosomal protein L13 |
| SGD closest match: | S000002240 | RPL13A | 60S ribosomal protein L13-A |
| CGD closest match: | CAL0000201310 | RPL13 | 60S ribosomal protein L13 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01409_1 | 71.88% | 192 | 1e-71 | MIA_01409_1 |
| A0A170QYQ1_9ASCO | 62.05% | 195 | 3e-63 | 60S ribosomal protein L13 OS=Sugiyamaella lignohabitans GN=RPL13A PE=3 SV=1 |
| A0A0F7RRI9_GEOCN | 65.45% | 191 | 4e-63 | 60S ribosomal protein L13 OS=Geotrichum candidum GN=BN980_GECA02s08491g PE=3 SV=1 |
| UniRef50_Q876B2 | 60.32% | 189 | 1e-58 | 60S ribosomal protein L13 n=168 Tax=Eukaryota TaxID=2759 RepID=RL13_SACEX |
| Q6CEU6_YARLI | 60.73% | 191 | 6e-61 | 60S ribosomal protein L13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12826g PE=3 SV=2 |
| RL13A_YEAST | 60.32% | 189 | 1e-58 | 60S ribosomal protein L13-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL13A PE=1 SV=1 |
| A0A060T711_BLAAD | 65.46% | 194 | 5e-58 | 60S ribosomal protein L13 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19052g PE=3 SV=1 |
| RL13_CANAL | 57.14% | 189 | 1e-57 | 60S ribosomal protein L13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL13 PE=3 SV=1 |
| A0A1E4TAK8_9ASCO | 57.44% | 195 | 4e-57 | 60S ribosomal protein L13 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128660 PE=3 SV=1 |
| A0A1E3PGN5_9ASCO | 61.78% | 191 | 1e-51 | Ribosomal protein L13e OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83544 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9958
Predicted cleavage: 83
Protein family membership
- Ribosomal protein L13e (IPR001380)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01294 (Ribosomal_...)
-
no IPR
Unintegrated signatures
Protein sequence
>MCA_00659_2 MAIAKNYPIIKNHFRKHWQERVRVHFNQHGKKVARRTARAKKAALVAPRPTDLLRPVVRANTIKYNRKVRAGRGFTKEEL KAAGIAFNEARSIGIAADARRQNKSVEGFEVNVNRLKDYKKRLIVLPRNPEKAKAVEAEFKATAQVSNAAAFPIVQDAVE SGLRAVSTSSDSAFLTLRKARSDAKFAGMREKKARDAAAAEAEKKK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome