Protein

MCA_00635_1

Length
216 amino acids

Gene name: HHO1

Description: Linker histone H1/H5

Browser: contigA:1972668-1973817-

RNA-seq: read pairs 5334, FPKM 303.7, percentile rank 91.9% (100% = highest expression)

Protein function

Annotation:HHO1Linker histone H1/H5
KEGG:K11275H1_5 histone H1/5
EGGNOG:0PRZFFG10800.1Histone H1
SGD closest match:S000006048HHO1Histone H1
CGD closest match:CAL0000178866HHO1Histone

Protein alignments

%idAln lengthE-value
A0A0J9X6W2_GEOCN69.01%711e-28Similar to Saccharomyces cerevisiae YPL127C HHO1 Histone H1, linker histone with roles in meiosis and sporulation OS=Geotrichum candidum GN=BN980_GECA04s00890g PE=3 SV=1
A0A060T7I8_BLAAD66.67%725e-28Similar to uniprot|P53551 Saccharomyces cerevisiae YPL127C HHO1 Histone H1, a linker histone required for nucleosome packaging at restricted sites OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B19515g PE=3 SV=1
A0A1D8PR93_CANAL68.57%707e-26Histone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HHO1 PE=3 SV=1
UniRef50_Q6BTR565.71%701e-21DEHA2C16478p n=8 Tax=saccharomyceta TaxID=716545 RepID=Q6BTR5_DEBHA
A0A1E3PD31_9ASCO63.77%695e-25Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48166 PE=3 SV=1
Q6CEE5_YARLI58.33%728e-24YALI0B16280p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B16280g PE=3 SV=2
A0A167BXJ8_9ASCO63.08%652e-23Histone H1 OS=Sugiyamaella lignohabitans GN=HHO1 PE=3 SV=1
MIA_01321_160.00%652e-20MIA_01321_1
H1_YEAST54.05%745e-18Histone H1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HHO1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1879

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 216

Detailed signature matches

  1. Family IPR005819
    Histone H5
    1. PR00624 (HISTONEH5)
  2. Domain IPR011991
    Winged helix-turn-helix DNA-binding domain
    1. G3DSA:1.10.10.10
    2. SSF46785 ("Winged h...)
  3. Domain IPR005818
    Linker histone H1/H5, domain H15
    1. PF00538 (Linker_his...)
    2. SM00526 (h15plus2)
    3. PS51504 (H15)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd00073 (H15)
  2. mobidb-lite (disord...)

Residue annotation

  1. DNA-binding site c...
  2. DNA-binding site c...

Protein sequence

>MCA_00635_1
MSATKTKETPTKPAKETTSKPAAKKPSHPTYKDMIKEAISELKERNGSSRYALKKYIQSTYNLEPSASFDSLFNSSLKKG
VVAGEFLMPKGPSGTVKLVKKEAEKKPKAAAKKVVKKDTEKKTTKAAAPKKKETAKKTETKKAEPKKKETAAKKTDTKKT
ETKKAEPKKKETATKKKTEKKSATAPKKTAGSSVTKKSTTVRKSRATPAATVAAAA

GO term prediction

Biological Process

GO:0006334 nucleosome assembly

Molecular Function

GO:0003677 DNA binding

Cellular Component

GO:0000786 nucleosome
GO:0005634 nucleus