MCA_00616_1
Gene name: ATP2
Description: ATP synthase subunit beta, mitochondrial
Browser: contigA:1890432-1892460-
RNA-seq: read pairs 168636, FPKM 4126.1, percentile rank 99.2% (100% = highest expression)
Protein function
Annotation: | ATP2 | ATP synthase subunit beta, mitochondrial | |
---|---|---|---|
KEGG: | K02133 | ATPeF1B | F-type H+-transporting ATPase subunit beta [EC:3.6.3.14] |
EGGNOG: | 0PIAZ | ATP2 | Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity) |
SGD closest match: | S000003882 | ATP2 | ATP synthase subunit beta, mitochondrial |
CGD closest match: | CAL0000193508 | ATP2 | ATP synthase subunit beta |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01383_1 | 92.89% | 506 | 0.0 | MIA_01383_1 |
A0A0J9X4A1_GEOCN | 92.46% | 504 | 0.0 | ATP synthase subunit beta OS=Geotrichum candidum GN=BN980_GECA02s03475g PE=3 SV=1 |
A0A1E3PE43_9ASCO | 87.13% | 505 | 0.0 | ATP synthase subunit beta OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84298 PE=3 SV=1 |
Q6CFT7_YARLI | 87.40% | 508 | 0.0 | ATP synthase subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B03982g PE=1 SV=2 |
A0A1D8PKZ9_CANAL | 84.92% | 504 | 0.0 | ATP synthase subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP2 PE=3 SV=1 |
A0A060T657_BLAAD | 88.94% | 461 | 0.0 | ATP synthase subunit beta OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B13332g PE=3 SV=1 |
ATPB_YEAST | 82.63% | 501 | 0.0 | ATP synthase subunit beta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP2 PE=1 SV=2 |
UniRef50_P00830 | 82.63% | 501 | 0.0 | ATP synthase subunit beta, mitochondrial n=379 Tax=root TaxID=1 RepID=ATPB_YEAST |
A0A1E4THZ8_9ASCO | 81.73% | 509 | 0.0 | ATP synthase subunit beta OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3045 PE=3 SV=1 |
A0A167FYV3_9ASCO | 92.27% | 414 | 0.0 | ATP synthase subunit beta OS=Sugiyamaella lignohabitans GN=ATP2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9865
Predicted cleavage: 28
Protein family membership
- ATP synthase, F1 complex, beta subunit (IPR005722)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches

-
-
-
PIRSF039072 (ATPase...)
-
SSF47917 (C-termina...)
-
cd01133 (F1-ATPase_...)
Residue annotation
-
alpha subunit inte...
-
Walker A motif cd0...
-
ATP binding site c...
-
Walker B motif cd0...
-
inhibitor binding ...
Protein sequence
>MCA_00616_1 MVAPRLSTVSRSVLRAAQNVNVIGRRTMATEAAATGTIRTVIGAVVDVQFKQDNLPAILNALTITRDNGEKLVLEVAQHL GENTVRTIAMDGTEGLVRGQEVIDTGAPITIPVGRGTLGRIINVIGEPIDERGPIKASKYAPIHTEPPTFAEQSTSAEVL ETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKETGVINLEGDSK VALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGALQE RITTTQKGSVTSVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRLLDPEVIGHEHYEVATQV QQTLQAYKSLQDIIAILGMDELSEADKLTVERARKIQRFLSQPFAVAEVFTGIEGRLVPLKETVRSFKEILEGKYDHLPE AAFYMVGSIDEVVSKAEKLAAEAA
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
GO:0015992 proton transport
GO:0046034 ATP metabolic process
Molecular Function
GO:0005524 ATP binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)