Protein
MCA_00573_1
Length
223 amino acids
Gene name: MOG1
Description: Nuclear import protein MOG1
Browser: contigA:1769135-1769807+
RNA-seq: read pairs 1221, FPKM 67.4, percentile rank 71.7% (100% = highest expression)
Protein function
Annotation: | MOG1 | Nuclear import protein MOG1 | |
---|---|---|---|
EGGNOG: | 0PPM5 | MOG1 | Ran GTPase binding |
SGD closest match: | S000003835 | MOG1 | Nuclear import protein MOG1 |
CGD closest match: | CAL0000182221 | orf19.3446 | Ran GTPase-binding protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01726_1 | 55.61% | 214 | 9e-69 | MIA_01726_1 |
A0A0J9XG85_GEOCN | 43.98% | 216 | 1e-50 | Similar to Saccharomyces cerevisiae YJR074W MOG1 Conserved nuclear protein that interacts with GTP-Gsp1p OS=Geotrichum candidum GN=BN980_GECA13s00241g PE=4 SV=1 |
UniRef50_A0A0J9XG85 | 43.98% | 216 | 3e-47 | Similar to Saccharomyces cerevisiae YJR074W MOG1 Conserved nuclear protein that interacts with GTP-Gsp1p n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XG85_GEOCN |
A0A060T7Z2_BLAAD | 31.92% | 213 | 1e-34 | ARAD1D06336p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D06336g PE=4 SV=1 |
A0A161HK26_9ASCO | 34.82% | 224 | 7e-26 | Mog1p OS=Sugiyamaella lignohabitans GN=MOG1 PE=4 SV=1 |
MOG1_YEAST | 28.64% | 220 | 3e-20 | Nuclear import protein MOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOG1 PE=1 SV=1 |
Q6CG95_YARLI | 31.25% | 208 | 2e-20 | YALI0A21098p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A21098g PE=4 SV=1 |
A0A1E3PN78_9ASCO | 31.00% | 229 | 5e-19 | Mog1p/PsbP-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82166 PE=4 SV=1 |
A0A1E4TKB0_9ASCO | 27.98% | 218 | 9e-14 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30422 PE=4 SV=1 |
Q5A4J5_CANAL | 28.19% | 227 | 4e-13 | Ran GTPase-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3446 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1043
Protein family membership
- Ran-interacting Mog1 protein (IPR007681)
Domains and repeats
-
Domain
1
50
100
150
223
Detailed signature matches

Unintegrated signatures
Protein sequence
>MCA_00573_1 MASTATQQFQSTGLYGGAMTVDLAPGFIDASNFREIPDTQEVYVHQEVDDSVVFDLLESVESAAHLDALKEHLHEISRIN NDDPESQLVQLYTNTIDLKQTSLKDVDVSKAAITVAIEPAKKWGRTTKLEKEGNEETLEEPILVMILSLIRLANVQTDLL ITYNTPITKVKDLNALETVFNGKDKPIASIEELPERIKQGLEAIEVITKTLEVKDWGLFGTES
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.