Protein
MCA_00526_1
Length
80 amino acids
Gene name: COA4
Description: Cytochrome oxidase assembly factor 4
Browser: contigA:1643674-1644096-
RNA-seq: read pairs 487, FPKM 74.3, percentile rank 73.8% (100% = highest expression)
Protein function
Annotation: | COA4 | Cytochrome oxidase assembly factor 4 | |
---|---|---|---|
KEGG: | K18177 | COA4 | cytochrome c oxidase assembly factor 4 |
EGGNOG: | 0PQYJ | Inherit from opiNOG: mitochondrial respiratory chain complex assembly | |
SGD closest match: | S000004208 | COA4 | Cytochrome oxidase assembly factor 4 |
CGD closest match: | CAL0000195080 | orf19.1667.1 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_G2XYI5 | 54.00% | 100 | 5e-25 | Uncharacterized protein n=1 Tax=Botryotinia fuckeliana (strain T4) TaxID=999810 RepID=G2XYI5_BOTF4 |
A0A1E3PMJ7_9ASCO | 67.69% | 65 | 2e-26 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51427 PE=4 SV=1 |
COA4_YEAST | 56.92% | 65 | 1e-22 | Cytochrome oxidase assembly factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA4 PE=1 SV=2 |
A0A0J9XCT5_GEOCN | 65.15% | 66 | 6e-18 | Similar to Saccharomyces cerevisiae YLR218C COA4 Twin Cx(9)C protein involved in cytochrome c oxidase organization OS=Geotrichum candidum GN=BN980_GECA10s00796g PE=4 SV=1 |
A0A1D8PJ94_CANAL | 62.96% | 54 | 2e-15 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1667.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0035
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
PS51808 (CHCH)
-
mobidb-lite (disord...)
Protein sequence
>MCA_00526_1 MSNNPENKLSQVEDDDEPDEWDQRINKTGCAEENMKLTDCHAEKKDWRLCMAEMDAFKKCWQKNHNDERTSTKDATIPNN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.