Protein
MCA_00520_1
Length
201 amino acids
Gene name: PTH1
Description: Peptidyl-tRNA hydrolase
Browser: contigA:1629288-1629952+
RNA-seq: read pairs 299, FPKM 18.3, percentile rank 39.0% (100% = highest expression)
Protein function
| Annotation: | PTH1 | Peptidyl-tRNA hydrolase | |
|---|---|---|---|
| KEGG: | K01056 | PTH1 | peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29] |
| EGGNOG: | 0PSBJ | PTH1 | Peptidyl-tRNA hydrolase |
| SGD closest match: | S000001232 | PTH1 | Peptidyl-tRNA hydrolase |
| CGD closest match: | CAL0000178920 | orf19.4740 | Aminoacyl-tRNA hydrolase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01083_1 | 55.02% | 209 | 3e-80 | MIA_01083_1 |
| A0A0J9XEP8_GEOCN | 41.00% | 200 | 7e-50 | Similar to Saccharomyces cerevisiae YHR189W PTH1 One of two (See also PTH2) mitochondrially-localized peptidyl-tRNA hydrolases OS=Geotrichum candidum GN=BN980_GECA11s00274g PE=4 SV=1 |
| UniRef50_A0A0J9XEP8 | 41.00% | 200 | 1e-46 | Similar to Saccharomyces cerevisiae YHR189W PTH1 One of two (See also PTH2) mitochondrially-localized peptidyl-tRNA hydrolases n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XEP8_GEOCN |
| A0A1E4TLP2_9ASCO | 34.66% | 176 | 2e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1281 PE=4 SV=1 |
| A0A060T9T8_BLAAD | 31.16% | 199 | 4e-22 | ARAD1C40238p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C40238g PE=4 SV=1 |
| PTH_YEAST | 31.79% | 195 | 5e-22 | Peptidyl-tRNA hydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTH1 PE=1 SV=1 |
| A0A167FSK8_9ASCO | 37.69% | 130 | 9e-22 | Pth1p OS=Sugiyamaella lignohabitans GN=PTH1 PE=4 SV=1 |
| Q5APM6_CANAL | 31.72% | 186 | 3e-19 | Aminoacyl-tRNA hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4740 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5230
Protein family membership
- Peptidyl-tRNA hydrolase (IPR001328)
Domains and repeats
None predicted.
Detailed signature matches
Residue annotation
-
putative active si...
-
catalytic residue ...
Protein sequence
>MCA_00520_1 MSKNPFFVISSIGNPGAKYAYTKHNVGHQMLIRFSKDLNLPVPTKKEGVHGGLATIPSSLAIQSSPFMLYQNSSFMNKSG ETLKSFWSTWIKKYRPDTKWNPQLIVLRDELDLEIGKIKYRAHSRTTNGHNGLKSLKQCLDLDWTDIAVGIGRPASKDSK EVASYVLSPFNNGQKTALFEESYPQVRDLLLNILDSGSVDI
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004045 aminoacyl-tRNA hydrolase activity
Cellular Component
None predicted.