Protein

MCA_00507_2

Length
106 amino acids


Gene name: RPL44

Description: 60S ribosomal protein L44

Browser: contigA:1597907-1598604-

RNA-seq: read pairs 37521, FPKM 4332.8, percentile rank 99.3% (100% = highest expression)

Protein function

Annotation:RPL4460S ribosomal protein L44
KEGG:K02929RP-L44e large subunit ribosomal protein L44e
EGGNOG:0PPNDRPL4460s ribosomal protein
SGD closest match:S000001183RPL42B60S ribosomal protein L42-B
CGD closest match:CAL0000190451RPL42Ribosomal 60S subunit protein L42A

Protein alignments

%idAln lengthE-value
MIA_00785_194.34%1062e-61MIA_00785_1
UniRef50_B8NBW085.85%1065e-5860S ribosomal protein L44 n=4 Tax=Aspergillus TaxID=5052 RepID=B8NBW0_ASPFN
A0A1D8PEV4_CANAL91.51%1066e-60Ribosomal 60S subunit protein L42A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL42 PE=3 SV=1
A0A0J9XHX5_GEOCN92.45%1061e-59Similar to Saccharomyces cerevisiae YHR141C RPL42B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA18s01088g PE=3 SV=1
A0A1E4TG43_9ASCO86.79%1067e-60Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2419 PE=3 SV=1
A0A060T447_BLAAD93.40%1062e-59ARAD1C41294p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C41294g PE=3 SV=1
RL44_YARLI89.62%1065e-5760S ribosomal protein L44 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPL44 PE=3 SV=3
RL44B_YEAST86.79%1061e-5460S ribosomal protein L42-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL42B PE=1 SV=1
A0A1E3PK20_9ASCO87.74%1061e-5360S ribosomal protein L44 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41683 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9425
Predicted cleavage: 47

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 70 80 90 100 106

Detailed signature matches

    1. PF00935 (Ribosomal_L44)
    2. PS01172 (RIBOSOMAL_...)
    1. SSF57829 (Zn-bindin...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_00507_2
MVNIPKTRRTFCASKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQSGYGGQTKQVFHKKAKTTKKVVLRLECTVCKTK
AQLPLKRCKHFELGGDKKQKGQALQF

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome