Protein

MCA_00467_1

Length
165 amino acids


Gene name: RPL12

Description: Ribosomal 60S subunit protein L12A

Browser: contigA:1467249-1468021-

RNA-seq: read pairs 59713, FPKM 4444.7, percentile rank 99.4% (100% = highest expression)

Protein function

Annotation:RPL12Ribosomal 60S subunit protein L12A
KEGG:K02870RP-L12e large subunit ribosomal protein L12e
EGGNOG:0PN4ARPL1260S ribosomal protein L12
SGD closest match:S000000780RPL12A60S ribosomal protein L12-A
CGD closest match:CAL0000181929RPL12Ribosomal 60S subunit protein L12A

Protein alignments

%idAln lengthE-value
MIA_00645_193.33%1657e-99MIA_00645_1
A0A0J9X4B3_GEOCN91.52%1655e-97Similar to Saccharomyces cerevisiae YDR418W RPL12B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA02s03893g PE=3 SV=1
Q6C955_YARLI88.96%1634e-93YALI0D13882p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13882g PE=3 SV=2
A0A060T5C8_BLAAD87.27%1651e-92ARAD1C04488p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C04488g PE=3 SV=1
A0A1E3PJ20_9ASCO83.44%1632e-86Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70882 PE=3 SV=1
A0A1E4TEZ5_9ASCO75.76%1653e-81Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_105157 PE=3 SV=1
Q5AJF7_CANAL76.69%1635e-79Ribosomal 60S subunit protein L12A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL12 PE=3 SV=1
UniRef50_P3005071.95%1647e-7660S ribosomal protein L12 n=59 Tax=Opisthokonta TaxID=33154 RepID=RL12_HUMAN
RL12A_YEAST76.07%1631e-7760S ribosomal protein L12-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL12A PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0074

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 165

Detailed signature matches

    1. MF_00736 (Ribosomal...)
    2. SM00649 (rl11c)
    3. cd00349 (Ribosomal_L11)
    1. SSF54747 (Ribosomal...)
    2. PF03946 (Ribosomal_...)
    1. PF00298 (Ribosomal_L11)
    2. SSF46906 (Ribosomal...)
    1. PS00359 (RIBOSOMAL_L11)

Residue annotation

  1. L7/L12 interface c...
  2. 23S rRNA interface...
  3. putative thiostrep...
  4. L25 interface cd00...

Protein sequence

>MCA_00467_1
MPPKFDPNEIKIIYLRATGGEVGASAALAPKIGPLGLSPKKIGEDIAKATKAYKGIRVTVQLTIQNRQAQVSVVPSASSL
VIGALKEPPRDRKKEKNIKHNGNIPLEEIINIAREMRSKSFAKELVGTVKEILGTAQSVGAKVNGKPAHVTIEAINKGEV
DIPSE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome