MCA_00457_1
Gene name: ARC35
Description: Subunit of the ARP2/3 complex; ARP2/3 is required for the motility and integrity of cortical actin patches
Browser: contigA:1451970-1452933-
RNA-seq: read pairs 8832, FPKM 340.0, percentile rank 92.6% (100% = highest expression)
Protein function
| Annotation: | ARC35 | Subunit of the ARP2/3 complex; ARP2/3 is required for the motility and integrity of cortical actin patches | |
|---|---|---|---|
| KEGG: | K05758 | ARPC2 | actin related protein 2/3 complex, subunit 2 |
| EGGNOG: | 0PFCE | FG07054.1 | arp2 3 complex 34 kda subunit |
| SGD closest match: | S000005318 | ARC35 | Actin-related protein 2/3 complex subunit 2 |
| CGD closest match: | CAL0000181673 | ARC35 | Arp2/3 complex 34 kDa subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00655_1 | 84.57% | 311 | 0.0 | MIA_00655_1 |
| A0A0J9XET0_GEOCN | 78.36% | 305 | 3e-178 | Arp2/3 complex 34 kDa subunit OS=Geotrichum candidum GN=BN980_GECA12s03816g PE=3 SV=1 |
| A0A1E3PPS5_9ASCO | 73.67% | 319 | 2e-172 | Arp2/3 complex 34 kDa subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21335 PE=3 SV=1 |
| A0A167D689_9ASCO | 77.93% | 290 | 6e-170 | Arp2/3 complex 34 kDa subunit OS=Sugiyamaella lignohabitans GN=ARC35 PE=3 SV=1 |
| Q6CHZ7_YARLI | 68.94% | 322 | 4e-157 | Arp2/3 complex 34 kDa subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A03025g PE=3 SV=1 |
| A0A1E4TDV9_9ASCO | 67.75% | 307 | 3e-152 | Arp2/3 complex 34 kDa subunit OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_26628 PE=3 SV=1 |
| A0A060T374_BLAAD | 63.90% | 313 | 1e-148 | Arp2/3 complex 34 kDa subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C30228g PE=3 SV=1 |
| UniRef50_A1CS18 | 61.37% | 321 | 2e-136 | Arp2/3 complex 34 kDa subunit n=20 Tax=Fungi TaxID=4751 RepID=A1CS18_ASPCL |
| Q5AA47_CANAL | 53.20% | 344 | 2e-107 | Arp2/3 complex 34 kDa subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARC35 PE=3 SV=1 |
| ARPC2_YEAST | 44.51% | 337 | 2e-76 | Actin-related protein 2/3 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARC35 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2029
Protein family membership
- Arp2/3 complex subunit 2/4 (IPR034666)
- Actin-related protein 2/3 complex subunit 2 (IPR007188)
Domains and repeats
Detailed signature matches
no IPR
-
mobidb-lite (disord...)
Protein sequence
>MCA_00457_1 MLLLQYHNLLLKSILTERLEPGAQPVSIDQTVSDFDNVTFHISTPESKTKILISMYIKCASDLKKYGVDDLMKREYGPYL LETPENGYDFSLSLDLEQLGDLDVTERNELIDKISLLKRNALAAPFELAFSQFDELAADAAQKSLDLYVPEASKTEVLAI HYRPEESIFIKASHDRVTVVFSTVFKDETDRVFGKVFLQEFVDARKRAIQNAPQVLYSQKEPPLEIRDLPGVKTSDDIGY VTFVLFPRHLAPQRRETCISHIETFRDYFHYHIKCSKAYMHSRMRYRVSEFLKVLNRAKPENEEKERKTASGRRFDSNRR
GO term prediction
Biological Process
GO:0030041 actin filament polymerization
GO:0030833 regulation of actin filament polymerization
GO:0034314 Arp2/3 complex-mediated actin nucleation
Molecular Function
None predicted.
Cellular Component
GO:0005885 Arp2/3 protein complex
GO:0015629 actin cytoskeleton