Protein

MCA_00452_1

Length
227 amino acids

Gene name: RIP1

Description: Cytochrome b-c1 complex subunit Rieske, mitochondrial ubiquinol-cytochrome c reductase iron-sulfur subunit

Browser: contigA:1442596-1443793-

RNA-seq: read pairs 23185, FPKM 1256.5, percentile rank 97.0% (100% = highest expression)

Protein function

Annotation:RIP1Cytochrome b-c1 complex subunit Rieske, mitochondrial ubiquinol-cytochrome c reductase iron-sulfur subunit
KEGG:K00411UQCRFS1 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2]
EGGNOG:0PFIAFG05251.1Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis (By similarity)
SGD closest match:S000000750RIP1Cytochrome b-c1 complex subunit Rieske, mitochondrial
CGD closest match:CAL0000191527RIP1Cytochrome b-c1 complex subunit Rieske, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_00535_186.89%2069e-136MIA_00535_1
A0A0J9XEF0_GEOCN80.69%2028e-126Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Geotrichum candidum GN=BN980_GECA12s03937g PE=4 SV=1
Q6CI02_YARLI74.88%2073e-118Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A02915g PE=4 SV=1
A0A060T8N4_BLAAD75.26%1901e-110Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C30294g PE=4 SV=1
A0A161HUG8_9ASCO73.04%2043e-110Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Sugiyamaella lignohabitans GN=RIP1 PE=4 SV=1
UniRef50_A0A161HUG873.04%2048e-107Cytochrome b-c1 complex subunit Rieske, mitochondrial n=44 Tax=Eukaryota TaxID=2759 RepID=A0A161HUG8_9ASCO
A0A1E3PRG6_9ASCO70.53%2079e-109Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81912 PE=4 SV=1
UCRI_YEAST67.16%2046e-108Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIP1 PE=1 SV=1
A0A1E4TI30_9ASCO70.26%1958e-105Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3123 PE=4 SV=1
A0A1D8PJX3_CANAL73.22%1833e-100Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIP1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9980
Predicted cleavage: 36

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 227

Detailed signature matches

  1. Domain IPR004192
    Ubiquinol cytochrome reductase, transmembrane domain
    1. PF02921 (UCR_TM)
    2. G3DSA:1.20.5.270
  2. Domain IPR006317
    Ubiquinol-cytochrome c reductase, iron-sulphur subunit
    1. TIGR01416
  3. Domain IPR017941
    Rieske [2Fe-2S] iron-sulphur domain
    1. G3DSA:2.102.1...
    2. SSF50022 (ISP domain)
    3. PS51296 (RIESKE)
    4. PF00355 (Rieske)
  4. Domain IPR005805
    Rieske iron-sulphur protein, C-terminal
    1. PR00162 (RIESKE)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SSF81502 (ISP trans...)
  7. cd03470 (Rieske_cyt...)

Residue annotation

  1. [2Fe-2S] cluster b...

Protein sequence

>MCA_00452_1
MSSLTILRSALSSSRAATRSLTPFKAVTALNQKRFNSSNPIGGSTYNVPDYSPYLKENRNTDANRVASYFVVGTFGMVSA
AAAKATVQDFLASMSASADVLALAKVEVNLAAIPEGRNVIIKWRGKPVFIRHRTSHEIEEANQVDMSSLRDPQTDSDRVK
DPHWLVMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPEYQLDGDSLVIG

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0008121 ubiquinol-cytochrome-c reductase activity
GO:0016491 oxidoreductase activity
GO:0051537 2 iron, 2 sulfur cluster binding

Cellular Component

GO:0016020 membrane