Protein

MCA_00416_1

Length
156 amino acids


Gene name: RPS11

Description: Protein component of the small (40S) ribosomal subunit

Browser: contigA:1307847-1308755+

RNA-seq: read pairs 49270, FPKM 3877.6, percentile rank 99.1% (100% = highest expression)

Protein function

Annotation:RPS11Protein component of the small (40S) ribosomal subunit
KEGG:K02949RP-S11e small subunit ribosomal protein S11e
EGGNOG:0PFMTFG00671.140S ribosomal protein S11
SGD closest match:S000000252RPS11B40S ribosomal protein S11-B
CGD closest match:CAL0000187802orf19.4149.1Ribosomal 40S subunit protein S11A

Protein alignments

%idAln lengthE-value
MIA_03568_189.10%1562e-103MIA_03568_1
A0A0J9XHE9_GEOCN86.62%1572e-98Similar to Saccharomyces cerevisiae YBR048W RPS11B Protein component of the small (40S) ribosomal subunit, identical to Rps11Ap OS=Geotrichum candidum GN=BN980_GECA18s00626g PE=3 SV=1
A0A1E3PFB4_9ASCO83.33%1565e-98Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39388 PE=3 SV=1
A0A060TBV4_BLAAD82.05%1569e-96ARAD1D37708p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D37708g PE=3 SV=1
A0A1D8PN83_CANAL83.33%1565e-94Ribosomal 40S subunit protein S11A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4149.1 PE=3 SV=1
A0A1E4TFQ9_9ASCO80.13%1562e-93Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_108262 PE=3 SV=1
Q6C0Z7_YARLI81.17%1544e-92YALI0F20482p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F20482g PE=3 SV=1
RS11B_YEAST76.92%1562e-8740S ribosomal protein S11-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS11B PE=1 SV=1
UniRef50_P0CX4776.92%1564e-8440S ribosomal protein S11-A n=528 Tax=Eukaryota TaxID=2759 RepID=RS11A_YEAST
A0A161HJL7_9ASCO87.01%772e-46Ribosomal 40S subunit protein S11A OS=Sugiyamaella lignohabitans GN=RPS11A PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0310

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 156

Detailed signature matches

    1. PR00973 (RIBOSOMALS17)
    2. PF00366 (Ribosomal_S17)
    1. PF16205 (Ribosomal_...)
    1. SSF50249 (Nucleic a...)
    1. PS00056 (RIBOSOMAL_S17)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_00416_1
MATELSVQSEKAFQKQPHIFQYSKAKVNKETKRWYKEVGLGFKTPAEAINGHYIDKKCPFVGLVSIRGKILTGTVVSTKM
HRTIIIRRDYLHYIPKYNRYEKRHKNIAAHVSPAFRVEEGDQVTVGQCRPLSKTVRFNVLRVTPGAKAGKKQFTKF

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome