Protein
MCA_00374_1
Length
383 amino acids
Gene name: COQ2
Description: 4-hydroxybenzoate polyprenyltransferase, mitochondrial
Browser: contigA:1166969-1168121-
RNA-seq: read pairs 963, FPKM 31.0, percentile rank 53.6% (100% = highest expression)
Protein function
| Annotation: | COQ2 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial | |
|---|---|---|---|
| KEGG: | K06125 | COQ2 | 4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39] |
| EGGNOG: | 0PFPH | COQ2 | para-hydroxybenzoate-polyprenyltransferase |
| SGD closest match: | S000005324 | COQ2 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial |
| CGD closest match: | CAL0000191686 | COQ2 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01438_1 | 80.06% | 321 | 0.0 | MIA_01438_1 |
| A0A0J9XCV8_GEOCN | 76.07% | 326 | 2e-168 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Geotrichum candidum GN=COQ2 PE=3 SV=1 |
| A0A060TDC0_BLAAD | 68.42% | 304 | 5e-154 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Blastobotrys adeninivorans GN=COQ2 PE=3 SV=1 |
| A0A167F8M1_9ASCO | 69.33% | 326 | 4e-150 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Sugiyamaella lignohabitans GN=COQ2 PE=3 SV=1 |
| A0A1E3PS87_9ASCO | 66.44% | 289 | 5e-139 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=COQ2 PE=3 SV=1 |
| Q6C2S2_YARLI | 61.56% | 307 | 9e-133 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ2 PE=3 SV=1 |
| UniRef50_Q6C2S2 | 61.56% | 307 | 2e-129 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial n=5 Tax=Saccharomycetales TaxID=4892 RepID=Q6C2S2_YARLI |
| A0A1D8PU83_CANAL | 59.87% | 299 | 6e-127 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COQ2 PE=3 SV=1 |
| COQ2_YEAST | 60.47% | 301 | 1e-125 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ2 PE=1 SV=1 |
| A0A1E4TDE0_9ASCO | 59.12% | 296 | 1e-111 | 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=COQ2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9950
Predicted cleavage: 47
Protein family membership
- UbiA prenyltransferase family (IPR000537)
- 4-hydroxybenzoate polyprenyltransferase (IPR006370)
- 4-hydroxybenzoate octaprenyltransferase (IPR031103)
- 4-hydroxybenzoate polyprenyltransferase (IPR006370)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
cd13959 (PT_UbiA_COQ2)
Residue annotation
-
putative active si...
Protein sequence
>MCA_00374_1 MFSYMYTTPRSAWTASFSSTFKTASRIRTAPVVPKSLSSQYQSQRWTATSSTPSSAPNEIELPVVSKDSPLLTQDPATMT MPQKFVRSLPNSLIPYAELMRMDKPIGTWLLYSPCTWSITMAAYTTSAPLLQTATMLGLFGAGALIMRGAGCTINDILDR NLDNKVGRTLTRPLARKAVTVPQAVGALAVQCTAGLGILLCLPSDCFWLGALSLPFIATYPLFKRFTYYPQASLSFCFTW GALLGFPAMGVWNIPAMLALHASSFFWCMTYDTIYAHQDKKFDIAAGIKSTALKWGTKTKPILAGMTVAQIGLLAASGVF NAMGPFFFASVGVAAYRVFSMIKKVDLDDPADCWKWFLNNIFTGHVIWFGCLGDYIGRLLGFF
GO term prediction
Biological Process
GO:0006744 ubiquinone biosynthetic process
Molecular Function
GO:0004659 prenyltransferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
Cellular Component
GO:0016021 integral component of membrane