Protein

MCA_00373_1

Length
369 amino acids


Gene name: JIP5

Description: WD repeat-containing protein JIP5

Browser: contigA:1165631-1166806+

RNA-seq: read pairs 587, FPKM 19.6, percentile rank 40.9% (100% = highest expression)

Protein function

Annotation:JIP5WD repeat-containing protein JIP5
EGGNOG:0PGDQJIP5WD repeat-containing protein JIP5
SGD closest match:S000006373JIP5WD repeat-containing protein JIP5
CGD closest match:CAL0000174164JIP5WD repeat-containing protein JIP5

Protein alignments

%idAln lengthE-value
MIA_01437_164.04%2925e-142MIA_01437_1
A0A0J9XBH1_GEOCN49.33%2981e-99Similar to Saccharomyces cerevisiae YPR169W JIP5 Essential protein required for biogenesis of the large ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA08s02320g PE=4 SV=1
UniRef50_A0A0J9XBH149.33%2983e-96Similar to Saccharomyces cerevisiae YPR169W JIP5 Essential protein required for biogenesis of the large ribosomal subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBH1_GEOCN
A0A060TIW0_BLAAD48.66%2983e-88ARAD1D49742p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49742g PE=4 SV=1
A0A1E3PQI2_9ASCO44.48%2993e-77WD40 repeat-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72267 PE=4 SV=1
JIP5_YARLI43.29%2981e-73WD repeat-containing protein JIP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=JIP5 PE=3 SV=1
JIP5_YEAST37.94%2827e-50WD repeat-containing protein JIP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JIP5 PE=1 SV=2
JIP5_CANAL34.27%2861e-38WD repeat-containing protein JIP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=JIP5 PE=3 SV=2
A0A1E4TGF1_9ASCO34.77%2794e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2525 PE=4 SV=1
A0A167F8P9_9ASCO47.40%1544e-38Jip5p OS=Sugiyamaella lignohabitans GN=JIP5 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4006

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Repeat
1 50 100 150 200 250 300 369

Detailed signature matches

    1. SSF50978 (WD40 repe...)
    1. SM00320 (WD40_4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_00373_1
MPRVLFKESLEEPLFCVSFSPVAANFVKGFADGRVTASSYDYEGNIKTLWTTKRHKGSCRAISYDFTGDLIFSVGLDRVL
KKANSKDGIVKIKNVDTIKSDPSCIAVNENYIAVGTDDGDLYVFEQTNLNLVKHIKDVHYDNMASIIPLIYKNKHHFVSC
GSSTVVHWDIRKEEPISESEDQEDEILCGCLASEKYMAFGMGTGVLTIWNEFLEDQQQRIRLSKESIDTVIPGELDNIVI
AGSSDGYAYKVDVKSSKILSKWKHGSDGVSFLEMDYDYHLVTADMENIKIWMTEEEEKKAIKEEKKKQKSEGDDSKDKKD
DSSDSDDWETEDEESKKKEDKKRKRKRGKASTKSKIHKTAPAIASFSDL

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.