Protein

MCA_00316_1

Length
119 amino acids


Gene name: CBP6

Description: Cytochrome B pre-mRNA-processing protein 6

Browser: contigA:961834-962194+

RNA-seq: read pairs 1641, FPKM 169.0, percentile rank 86.2% (100% = highest expression)

Protein function

Annotation:CBP6Cytochrome B pre-mRNA-processing protein 6
KEGG:K17663CBP6 cytochrome b pre-mRNA-processing protein 6
SGD closest match:S000000324CBP6Cytochrome B pre-mRNA-processing protein 6
CGD closest match:CAL0000190781orf19.2201Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_01642_178.99%1194e-57MIA_01642_1
A0A0J9XHZ1_GEOCN55.56%1171e-37Similar to Saccharomyces cerevisiae YBR120C CBP6 Mitochondrial protein required for translation of the COB mRNA OS=Geotrichum candidum GN=BN980_GECA17s01990g PE=4 SV=1
UniRef50_A0A0J9XHZ155.56%1172e-34Similar to Saccharomyces cerevisiae YBR120C CBP6 Mitochondrial protein required for translation of the COB mRNA n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHZ1_GEOCN
A0A1E3PIP3_9ASCO35.92%1035e-12Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83311 PE=4 SV=1
Q5A2K4_CANAL35.04%1171e-10Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2201 PE=4 SV=1
A0A060T4B1_BLAAD39.44%714e-07ARAD1C43450p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C43450g PE=4 SV=1
CBP6_YEAST41.51%533e-06Cytochrome B pre-mRNA-processing protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBP6 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1939

Protein family membership

None predicted.

Domains and repeats

None predicted.

Protein sequence

>MCA_00316_1
MASYPPTTTSIKALLQTFERWTPDSLKRYASFKDFGVERYQKLLNGPQSGLDARALALRARAADTIQKNVNKNTFACTDS
LLRPASNPIYYERLCRELAPTGKKTPMLTAIRHVVFGGY

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.