Protein
MCA_00301_1
Length
128 amino acids
Gene name: RPL40A
Description: Ubiquitin-60S ribosomal protein L40; cleaved to yield ubiquitin and ribosomal protein L40A
Browser: contigA:921816-922599-
RNA-seq: read pairs 60408, FPKM 5786.1, percentile rank 99.7% (100% = highest expression)
Protein function
Annotation: | RPL40A | Ubiquitin-60S ribosomal protein L40; cleaved to yield ubiquitin and ribosomal protein L40A | |
---|---|---|---|
KEGG: | K02927 | RP-L40e | large subunit ribosomal protein L40e |
EGGNOG: | 0QEEQ | ubiquitin-60S ribosomal protein L40 fusion protein | |
SGD closest match: | S000001410 | RPL40A | Ubiquitin-60S ribosomal protein L40 |
CGD closest match: | CAL0000178202 | UBI3 | Ubiquitin-ribosomal 40S subunit protein S31 fusion protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01336_1 | 100.00% | 128 | 4e-91 | MIA_01336_1 |
Q6C2D7_YARLI | 97.66% | 128 | 4e-90 | YALI0F08745p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08745g PE=4 SV=1 |
UniRef50_B6QKR0 | 97.66% | 128 | 1e-86 | Ubiquitin UbiA, putative n=4 Tax=saccharomyceta TaxID=716545 RepID=B6QKR0_TALMQ |
A0A1E3PF69_9ASCO | 96.88% | 128 | 1e-89 | Ubiquitin-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_61794 PE=4 SV=1 |
RL40A_YEAST | 96.09% | 128 | 2e-89 | Ubiquitin-60S ribosomal protein L40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL40A PE=1 SV=1 |
A0A060SZM2_BLAAD | 96.09% | 128 | 1e-88 | ARAD1C09262p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09262g PE=4 SV=1 |
A0A0F7RSR8_GEOCN | 96.09% | 128 | 1e-88 | Similar to Saccharomyces cerevisiae YIL148W RPL40A Ubiquitin-ribosomal 60S subunit protein L40A fusion protein OS=Geotrichum candidum GN=BN980_GECA06s01506g PE=4 SV=1 |
Q5A109_CANAL | 100.00% | 76 | 1e-48 | Ubiquitin-ribosomal 40S subunit protein S31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBI3 PE=4 SV=1 |
A0A167BXV7_9ASCO | 97.40% | 77 | 7e-49 | Ubiquitin OS=Sugiyamaella lignohabitans GN=UBI4 PE=4 SV=1 |
A0A1E4TLU1_9ASCO | 97.40% | 77 | 1e-48 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_21234 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1918
Protein family membership
- Ubiquitin (IPR019956)
Domains and repeats
-
Domain
-
Domain
1
20
40
60
80
100
128
Detailed signature matches
no IPR
Unintegrated signatures
-
-
cd01803 (Ubiquitin)
Residue annotation
-
Ubq - CUE interact...
-
Ubq - UCH interact...
-
Ubq - E2 interacti...
Protein sequence
>MCA_00301_1 MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGVIEP SLKALASKFNCEKAICRKCYARLPPRATNCRKRKCGHTNQLRPKKKLK
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Cellular Component
GO:0005840 ribosome