Protein
MCA_00274_1
Length
294 amino acids
Gene name: PEP8
Description: Vacuolar protein sorting-associated protein
Browser: contigA:831729-832698-
RNA-seq: read pairs 1166, FPKM 48.8, percentile rank 64.9% (100% = highest expression)
Protein function
| Annotation: | PEP8 | Vacuolar protein sorting-associated protein | |
|---|---|---|---|
| KEGG: | K18466 | VPS26 | vacuolar protein sorting-associated protein 26 |
| EGGNOG: | 0PHXC | FG01155.1 | Vacuolar protein sorting-associated protein |
| SGD closest match: | S000003589 | PEP8 | Carboxypeptidase Y-deficient protein 8 |
| CGD closest match: | CAL0000199432 | PEP8 | Retromer subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_01310_1 | 92.52% | 294 | 0.0 | MIA_01310_1 |
| A0A0J9X8Z3_GEOCN | 92.18% | 294 | 0.0 | Similar to Saccharomyces cerevisiae YJL053W VPS26 Vacuolar protein sorting protein that forms part of the multimeric membrane-associated retromer complex along with Vps35p, Vps29p, Vps17p, and Vps5p OS=Geotrichum candidum GN=BN980_GECA05s05972g PE=4 SV=1 |
| Q6C807_YARLI | 81.46% | 302 | 4e-180 | YALI0D23793p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23793g PE=4 SV=1 |
| A0A1E4TJZ5_9ASCO | 81.97% | 294 | 1e-179 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_81886 PE=4 SV=1 |
| A0A161HK22_9ASCO | 78.39% | 310 | 2e-176 | Retromer subunit PEP8 OS=Sugiyamaella lignohabitans GN=PEP8 PE=4 SV=1 |
| A0A1E3PRQ4_9ASCO | 76.05% | 309 | 8e-173 | Vacuolar protein sorting-associated protein 26 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_72551 PE=4 SV=1 |
| UniRef50_A0A0F7VDW9 | 79.52% | 293 | 3e-166 | Putative Vacuolar protein sorting-associated protein 26b-b n=64 Tax=Dikarya TaxID=451864 RepID=A0A0F7VDW9_9EURO |
| A0A060SWH1_BLAAD | 78.43% | 306 | 2e-170 | ARAD1A04664p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04664g PE=4 SV=1 |
| A0A1D8PJS7_CANAL | 61.27% | 346 | 6e-149 | Retromer subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PEP8 PE=4 SV=1 |
| PEP8_YEAST | 41.95% | 379 | 5e-93 | Carboxypeptidase Y-deficient protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP8 PE=1 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0449
Protein family membership
- Vacuolar protein sorting protein 26 related (IPR028934)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_00274_1 MSIFFKHPLDIEIRLAGEDKREHVDIKSPEKGRREKYPLYLDGESVKGTVTIRPKDGKKLEHTGIKVQFIGSIEMHNDRG VHDDFLSLGQELAAPAELRHPETFDFEFKNVEKQYESYNGANVRLRYYIRVTVFRRMADVVRDKDIWVYSYRNNLDSISS IKMDVGIEDCLHIEFEYSKSRYHLKDVIVGRIYFLLVRLKIKHMELSIIRRETVGSPPNQLSESETLVRFEIMDGAPVRG ETIPIRLFLGGFDLTPTFRDVNKKFSTRTFLSLVLIDEDARRYFKQSEIILYRQ
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.