Protein
MCA_00251_1
Length
162 amino acids
Description: carbonic anhydrase
Browser: contigA:764761-765250+
RNA-seq: read pairs 495, FPKM 37.5, percentile rank 58.9% (100% = highest expression)
Protein function
| Annotation: | carbonic anhydrase | ||
|---|---|---|---|
| KEGG: | K01673 | cynT | carbonic anhydrase [EC:4.2.1.1] |
| EGGNOG: | 0PNNX | FG02970.1 | carbonic anhydrase |
| CGD closest match: | CAL0000180005 | CAALFM_CR02780WA | Carbonic anhydrase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05003_1 | 83.95% | 162 | 4e-100 | MIA_05003_1 |
| UniRef50_G8Y0B1 | 77.78% | 162 | 2e-88 | Carbonic anhydrase n=38 Tax=cellular organisms TaxID=131567 RepID=G8Y0B1_PICSO |
| Q5A207_CANAL | 76.54% | 162 | 1e-88 | Carbonic anhydrase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR02780WA PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0242
Protein family membership
- Carbonic anhydrase (IPR001765)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
cd03379 (beta_CA_cl...)
Residue annotation
-
active site clefts...
-
zinc binding site ...
-
dimer interface cd...
Protein sequence
>MCA_00251_1 MSTAKEFEQANEKYASNFKKGDLALPPARKVAVVVCMDARIDPARALGLEEGDAHVIRNAGGRASDALRSVIISQQLLGT REIVVIHHTDCGMLTFRDEELREKLKDTTNVSADHFAFLPFSDLPKSVKEDVEFFKSSPYVLDVPVTGYIYDVKTGKIEK VE
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004089 carbonate dehydratase activity
GO:0008270 zinc ion binding
Cellular Component
None predicted.