Protein

MCA_00249_1

Length
60 amino acids

Gene name: COX17

Description: Cytochrome c oxidase copper chaperone

Browser: contigA:761535-761875-

RNA-seq: read pairs 6120, FPKM 1239.7, percentile rank 97.0% (100% = highest expression)

Protein function

Annotation:COX17Cytochrome c oxidase copper chaperone
KEGG:K02260COX17 cytochrome c oxidase assembly protein subunit 17
EGGNOG:0PS1KCOX17cytochrome C oxidase
SGD closest match:S000003932COX17Cytochrome c oxidase copper chaperone
CGD closest match:CAL0000195202COX17Copper metallochaperone

Protein alignments

%idAln lengthE-value
A0A1E3PH04_9ASCO81.08%372e-17Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52341 PE=4 SV=1
MIA_05758_181.08%373e-17MIA_05758_1
UniRef50_W0T9N272.97%379e-13Cytochrome c oxidase copper chaperone n=1 Tax=Kluyveromyces marxianus DMKU3-1042 TaxID=1003335 RepID=W0T9N2_KLUMA
A0A0J9XBZ2_GEOCN70.27%377e-15Similar to Saccharomyces cerevisiae YLL009C COX17 Copper metallochaperone that transfers copper to Sco1p and Cox11p for eventual delivery to cytochrome c oxidase OS=Geotrichum candidum GN=BN980_GECA07s03497g PE=4 SV=1
Q6CBM0_YARLI67.57%372e-12YALI0C17391p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C17391g PE=4 SV=2
COX17_YEAST64.86%374e-12Cytochrome c oxidase copper chaperone OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX17 PE=1 SV=3
A0A1D8PGA3_CANAL48.57%353e-07Copper metallochaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX17 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1012

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 60

Detailed signature matches

  1. Family IPR007745
    Cytochrome c oxidase copper chaperone
    1. PF05051 (COX17)
    2. PD014904
  2. Domain IPR009069
    Cysteine alpha-hairpin motif superfamily
    1. SSF47072 (Cysteine ...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.28...
  2. PS51808 (CHCH)

Protein sequence

>MCA_00249_1
MTETTSAPAASPSKPKPCCVCKPEKASRDECILLNGQESGKCDDLIVKYKTCMKGFGFEI

GO term prediction

Biological Process

GO:0006825 copper ion transport

Molecular Function

GO:0005507 copper ion binding
GO:0016531 copper chaperone activity

Cellular Component

GO:0005758 mitochondrial intermembrane space