Protein
MCA_00200_2
Length
91 amino acids
Gene name: SBH1
Description: Protein transport protein Sec61 subunit beta
Browser: contigA:627890-628775+
RNA-seq: read pairs 2156, FPKM 289.6, percentile rank 91.6% (100% = highest expression)
Protein function
Annotation: | SBH1 | Protein transport protein Sec61 subunit beta | |
---|---|---|---|
KEGG: | K09481 | SEC61B | protein transport protein SEC61 subunit beta |
EGGNOG: | 0PRXA | SBH1 | protein transport protein sec61 |
SGD closest match: | S000002127 | SBH2 | Protein transport protein SBH2 |
CGD closest match: | CAL0000178420 | CAALFM_CR01490CA | Protein transport protein Sec61 subunit beta |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_01299_1 | 84.44% | 90 | 1e-34 | MIA_01299_1 |
A0A060SYU0_BLAAD | 78.02% | 91 | 3e-33 | Protein transport protein Sec61 subunit beta OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A14454g PE=3 SV=1 |
A0A1E3PT10_9ASCO | 75.00% | 88 | 2e-32 | Protein transport protein Sec61 subunit beta OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_63840 PE=3 SV=1 |
A0A0J9XHV9_GEOCN | 77.91% | 86 | 2e-29 | Protein transport protein Sec61 subunit beta OS=Geotrichum candidum GN=BN980_GECA15s02606g PE=3 SV=1 |
SC61B_YARLI | 67.05% | 88 | 7e-28 | Protein transport protein Sec61 subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SBH1 PE=3 SV=1 |
UniRef50_Q9HFC7 | 67.05% | 88 | 2e-24 | Protein transport protein Sec61 subunit beta n=47 Tax=saccharomyceta TaxID=716545 RepID=SC61B_YARLI |
A0A1E4TL29_9ASCO | 76.67% | 60 | 8e-23 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_21565 PE=4 SV=1 |
A0A1D8PRY9_CANAL | 60.71% | 84 | 1e-21 | Protein transport protein Sec61 subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR01490CA PE=3 SV=1 |
SC6B2_YEAST | 53.49% | 86 | 4e-19 | Protein transport protein SBH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH2 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0598
Predicted cleavage: 18
Protein family membership
- Protein transport protein SecG/Sec61-beta/Sbh (IPR016482)
- Protein transport Sec61-beta/Sbh (IPR030671)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF03911 (Sec61_beta)
-
-
-
PIRSF006398 (Sec61_...)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_00200_2 MSSTAVPGGPKSAMKRRAAQERQTAAANEKPTSTRSAGAGGSSNTMLKLYTDEASGFRVDPIVVMVMALGFIFSVVALHG VAKISNKLFSS
GO term prediction
Biological Process
GO:0006886 intracellular protein transport
Molecular Function
None predicted.
Cellular Component
GO:0005784 Sec61 translocon complex