Protein

MCA_00138_1

Length
667 amino acids

Gene name: FRA1

Description: Xaa-Pro aminopeptidase

Browser: contigA:372660-374854-

RNA-seq: read pairs 15282, FPKM 282.7, percentile rank 91.4% (100% = highest expression)

Protein function

Annotation:FRA1Xaa-Pro aminopeptidase
KEGG:K01262pepP Xaa-Pro aminopeptidase [EC:3.4.11.9]
EGGNOG:0PFDGAMPPCatalyzes the removal of a penultimate prolyl residue from the N-termini of peptides (By similarity)
SGD closest match:S000003952FRA1Putative Xaa-Pro aminopeptidase FRA1
CGD closest match:CAL0000176020orf19.2095Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_05740_169.88%6740.0MIA_05740_1
A0A0J9XE81_GEOCN62.48%6210.0Similar to Saccharomyces cerevisiae YLL029W FRA1 Protein involved in negative regulation of transcription of iron regulon OS=Geotrichum candidum GN=BN980_GECA12s00813g PE=3 SV=1
UniRef50_A0A0J9X2V759.46%6240.0Similar to Saccharomyces cerevisiae YLL029W FRA1 Protein involved in negative regulation of transcription of iron regulon n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2V7_GEOCN
A0A161HGZ6_9ASCO55.97%6200.0Fra1p OS=Sugiyamaella lignohabitans GN=FRA1 PE=3 SV=1
A0A060TCM0_BLAAD54.29%6170.0ARAD1D43846p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D43846g PE=3 SV=1
A0A1E3PKS8_9ASCO49.30%6390.0Creatinase/aminopeptidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82914 PE=3 SV=1
Q6C5C7_YARLI47.13%6620.0YALI0E19184p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19184g PE=3 SV=1
A0A1E4TD11_9ASCO48.48%6250.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58443 PE=3 SV=1
A0A1D8PG26_CANAL43.68%6417e-178Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2095 PE=3 SV=1
FRA1_YEAST42.84%6634e-170Putative Xaa-Pro aminopeptidase FRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRA1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9875
Predicted cleavage: 39

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 667

Detailed signature matches

  1. Domain IPR029149
    Creatinase/Aminopeptidase P/Spt16, N-terminal
    1. G3DSA:3.40.35...
  2. Domain IPR028980
    Creatinase/Aminopeptidase P, N-terminal
    1. SSF53092 (Creatinas...)
  3. Domain IPR000587
    Creatinase, N-terminal
    1. PF01321 (Creatinase_N)
  4. Domain IPR000994
    Peptidase M24
    1. SSF55920 (Creatinas...)
    2. PF00557 (Peptidase_M24)
  5. Domain IPR033740
    Aminopeptidase P
    1. cd01085 (APP)
  6. Domain IPR032416
    Peptidase M24, C-terminal domain
    1. PF16188 (Peptidase_...)
  7. SITE IPR001131
    Peptidase M24B, X-Pro dipeptidase/aminopeptidase P, conserved site
    1. PS00491 (PROLINE_PE...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.90.23...
  2. PF16189 (Creatinase...)

Residue annotation

  1. active site cd01085

Protein sequence

>MCA_00138_1
MVYRIRYWQTNISSYRRHLFHILSANSRRLLTPQQIRHHSATAPMVEDTTKRLKSLRALFDKHEIGIYVVLTQDEHQSEY
PAACDLRREFISGFTGSAGIAIITKTKAALSTDGRYFLQAKNQLDSNWELLKQGVPGVPSWRDWVIKEAIDNGYNIGVDP
KLISYEEYSALVSKLKEYDLEDILVPVTPNLVDIVWGDARPQPSKDDVTILPIEYSGVSTKDKIIELRKAIEAHRGLGFV
VTALDDVAWLFNLRGTDIIYNPVFRAFAYVTAKKVTLYIDPDKINEEVANYLENDNIIVKPYEAIAEDLRQANTELIQHN
MSVKSINLKKKVLASESISWDLYRALGGKEYISFIPSPIESAKAIKNRVEIQGAKKCQIRDGAALIKYFAWLENELKNGR
KISDYDAGKKAEQFRSEMEKYRGLSFETISSSGPNAAVIHYAPEPDSKFMVDIDQVYLCDSGAQYLDGTTDTTRTLHFGT
PDPEIIHRYTLVLKGHISIARTIFPEGSNGMLIDVLARQFLWNEGLDYRHGTGHGVGSFLNVHEGPIGIGTRPHYGNAPL
RAGNILSNEPGYYKDGEYGIRIENVVLVTVNNKIPNEFGKKNLQFETITRVPLCRKLIDTSIMTEDEIKWVDEYHQIVYK
DTIPYITNNELAKAWLLRETAPLLSKE

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0016787 hydrolase activity
GO:0070006 metalloaminopeptidase activity

Cellular Component

None predicted.