Protein
MCA_00131_1
Length
144 amino acids
Gene name: RPS14
Description: 40S ribosomal protein S14
Browser: contigA:353894-354768-
RNA-seq: read pairs 30338, FPKM 2585.2, percentile rank 98.2% (100% = highest expression)
Protein function
| Annotation: | RPS14 | 40S ribosomal protein S14 | |
|---|---|---|---|
| KEGG: | K02955 | RP-S14e | small subunit ribosomal protein S14e |
| EGGNOG: | 0PP1Z | RPS14 | 40S ribosomal protein S14 |
| SGD closest match: | S000000627 | RPS14A | 40S ribosomal protein S14-A |
| CGD closest match: | CAL0000196584 | RPS14B | Ribosomal 40S subunit protein S14B |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XBY9_GEOCN | 94.74% | 133 | 1e-79 | Similar to Saccharomyces cerevisiae YCR031C RPS14A and YJL191W RPS15B, Ribosomal protein 59 of the small subunit, required for ribosome assembly and 20S pre-rRNA processing OS=Geotrichum candidum GN=BN980_GECA08s04806g PE=3 SV=1 |
| A0A060T8I9_BLAAD | 95.49% | 133 | 4e-79 | ARAD1D03916p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03916g PE=3 SV=1 |
| MIA_04173_1 | 96.09% | 128 | 3e-75 | MIA_04173_1 |
| A0A1E4TLZ7_9ASCO | 88.72% | 133 | 2e-71 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_43349 PE=3 SV=1 |
| A0A1E3PET2_9ASCO | 87.22% | 133 | 1e-69 | Ribosomal protein S11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_67490 PE=3 SV=1 |
| Q6CA55_YARLI | 83.46% | 133 | 6e-68 | YALI0D05753p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05753g PE=3 SV=2 |
| UniRef50_A0A178CD82 | 76.97% | 152 | 4e-62 | 40S ribosomal protein S14 n=13 Tax=Eukaryota TaxID=2759 RepID=A0A178CD82_9EURO |
| RS14A_YEAST | 87.70% | 122 | 1e-63 | 40S ribosomal protein S14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS14A PE=1 SV=5 |
| A0A1D8PDT3_CANAL | 92.11% | 114 | 4e-62 | Ribosomal 40S subunit protein S14B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS14B PE=3 SV=1 |
| A0A167E583_9ASCO | 95.06% | 81 | 3e-39 | Ribosomal 40S subunit protein S14A OS=Sugiyamaella lignohabitans GN=RPS14A PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0082
Protein family membership
- Ribosomal protein S11 (IPR001971)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF00411 (Ribosomal_S11)
-
-
MF_01310 (Ribosomal...)
-
PIRSF002131 (RPS11p...)
-
-
-
PS00054 (RIBOSOMAL_S11)
-
no IPR
Unintegrated signatures
-
SSF53137 (Translati...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_00131_1 MAPKNENVTLGLQAREGELVFGVARIFASFNDTFVHVTDLSGRETIARVTGGMKVKADHDESSPYAAMLAAQDVAAKCKE VGITALNFKIRATGGTGTKTPGPGAQSALRALARSGIRIGRIEDVTPVPSDSTRRKGGRRGRRL
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome