Protein

MCA_00121_1

Length
380 amino acids

Gene name: NCS6

Description: Cytoplasmic tRNA 2-thiolation protein 1

Browser: contigA:328043-329186+

RNA-seq: read pairs 358, FPKM 11.6, percentile rank 28.6% (100% = highest expression)

Protein function

Annotation:NCS6Cytoplasmic tRNA 2-thiolation protein 1
KEGG:K14168CTU1 cytoplasmic tRNA 2-thiolation protein 1 [EC:2.7.7.-]
EGGNOG:0PFE0NCS6Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated urm1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation
SGD closest match:S000003179NCS6Cytoplasmic tRNA 2-thiolation protein 1
CGD closest match:CAL0000179269NCS6Cytoplasmic tRNA 2-thiolation protein 1

Protein alignments

%idAln lengthE-value
MIA_04114_180.73%3840.0MIA_04114_1
A0A0J9XHU8_GEOCN75.32%3850.0Cytoplasmic tRNA 2-thiolation protein 1 OS=Geotrichum candidum GN=NCS6 PE=3 SV=1
A0A1E3PRY2_9ASCO72.77%3820.0Cytoplasmic tRNA 2-thiolation protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NCS6 PE=3 SV=1
CTU1_YARLI74.33%3740.0Cytoplasmic tRNA 2-thiolation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NCS6 PE=3 SV=1
A0A060TCQ2_BLAAD70.27%3700.0Cytoplasmic tRNA 2-thiolation protein 1 OS=Blastobotrys adeninivorans GN=NCS6 PE=3 SV=1
A0A167DLJ2_9ASCO84.12%2771e-179Cytoplasmic tRNA 2-thiolation protein 1 OS=Sugiyamaella lignohabitans GN=NCS6 PE=3 SV=1
UniRef50_Q6CWX664.40%3683e-168Cytoplasmic tRNA 2-thiolation protein 1 n=93 Tax=Eukaryota TaxID=2759 RepID=CTU1_KLULA
A0A1E4TDK7_9ASCO68.70%3458e-171Cytoplasmic tRNA 2-thiolation protein 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=NCS6 PE=3 SV=1
CTU1_YEAST61.62%3705e-164Cytoplasmic tRNA 2-thiolation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCS6 PE=1 SV=3
CTU1_CANAL60.32%3785e-161Cytoplasmic tRNA 2-thiolation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NCS6 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7613
Predicted cleavage: 25

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 380

Detailed signature matches

  1. Family IPR035107
    tRNA thiolation protein, TtcA/Ctu1 type
    1. PIRSF004976 (ATPase...)
  2. Family IPR000541
    Cytoplasmic tRNA 2-thiolation protein 1
    1. MF_03053 (CTU1)
  3. Domain IPR014729
    Rossmann-like alpha/beta/alpha sandwich fold
    1. G3DSA:3.40.50...
  4. Domain IPR011063
    tRNA(Ile)-lysidine/2-thiocytidine synthase, N-terminal
    1. PF01171 (ATP_bind_3)
  5. Domain IPR032442
    Cytoplasmic tRNA 2-thiolation protein 1, C-terminal
    1. PF16503 (zn-ribbon_14)
  6. SITE IPR020554
    Uncharacterised protein family UPF0021, conserved site
    1. PS01263 (UPF0021)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF52402 (Adenine n...)
  2. cd01993 (Alpha_ANH_...)
  3. mobidb-lite (disord...)

Residue annotation

  1. Ligand Binding Sit...

Protein sequence

>MCA_00121_1
MAGPTVKLPPCELCQTRRPVLRRPKTNQKLCKPCFFHVFETEIHNTITESNLFYPGERVAIGASGGKDSTVLAHVMKVLN
ERYNYGVEFVLLSIDEGIHGYRDDSLETVKRNKEQYSMDLEIISYGELYGWTMDQIVAQIGNKNNCTYCGVFRRQALDRG
AVKLGIKHIVTGHNADDMAETVLMNILRGDTARLDRCTEIVTDSTDSPVKRSKPLKYTYEKEIVLYAHYKQLDYFSTECT
YSPEAFRGTARTLIKNLESIRPSTIIDIIHCGETFTLKTKAEKMLKQRQLLKQPQEPKAKSADPLNRKKSNSDKFESQVK
REGRCERCGYLSNNTICKACVLLEGLNVGRAKLQIQIEGDETDQSKGSALLRKQLESISI

GO term prediction

Biological Process

GO:0002098 tRNA wobble uridine modification
GO:0008033 tRNA processing
GO:0034227 tRNA thio-modification

Molecular Function

GO:0000049 tRNA binding

Cellular Component

None predicted.