Protein
MCA_00106_1
Length
185 amino acids
Gene name: SPC3
Description: Microsomal signal peptidase subunit 3
Browser: contigA:283613-284171+
RNA-seq: read pairs 1131, FPKM 75.1, percentile rank 74.1% (100% = highest expression)
Protein function
| Annotation: | SPC3 | Microsomal signal peptidase subunit 3 | |
|---|---|---|---|
| KEGG: | K12948 | SPCS3 | signal peptidase complex subunit 3 [EC:3.4.-.-] |
| EGGNOG: | 0PNXH | SPC3 | Microsomal signal peptidase subunit |
| SGD closest match: | S000004056 | SPC3 | Signal peptidase complex subunit SPC3 |
| CGD closest match: | CAL0000195857 | SPC3 | Signal peptidase complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_04165_1 | 72.43% | 185 | 1e-99 | MIA_04165_1 |
| A0A0J9X9T1_GEOCN | 68.68% | 182 | 4e-90 | Similar to Saccharomyces cerevisiae YLR066W SPC3 Subunit of signal peptidase complex (Spc1p, Spc2p, Spc3p,Sec11p) OS=Geotrichum candidum GN=BN980_GECA05s03838g PE=4 SV=1 |
| UniRef50_A0A0J9X9T1 | 68.68% | 182 | 9e-87 | Similar to Saccharomyces cerevisiae YLR066W SPC3 Subunit of signal peptidase complex (Spc1p, Spc2p, Spc3p,Sec11p) n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X9T1_GEOCN |
| A0A060SXB0_BLAAD | 53.80% | 184 | 2e-69 | ARAD1A02816p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A02816g PE=4 SV=1 |
| A0A1E3PIG0_9ASCO | 52.17% | 184 | 1e-62 | Signal peptidase 22 kDa subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46933 PE=4 SV=1 |
| Q5AL47_CANAL | 46.74% | 184 | 9e-51 | Signal peptidase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPC3 PE=4 SV=1 |
| SPC3_YARLI | 49.14% | 175 | 2e-50 | Microsomal signal peptidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPC3 PE=3 SV=1 |
| A0A167ESX7_9ASCO | 61.67% | 120 | 2e-47 | Spc3p OS=Sugiyamaella lignohabitans GN=SPC3 PE=4 SV=1 |
| A0A1E4TLD3_9ASCO | 44.44% | 180 | 8e-44 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87868 PE=4 SV=1 |
| SPC3_YEAST | 43.75% | 176 | 1e-42 | Signal peptidase complex subunit SPC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4922
Predicted cleavage: 62
Protein family membership
- Signal peptidase complex subunit 3 (IPR007653)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF016089 (SPC3)
-
PF04573 (SPC22)
-
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_00106_1 MFSSLQRIQNAFGFYTTVILFVSGLISLISYVQLQNAGAFSLHPVLNNVEPKAYVKFTRRSGSVNGKGKENMRLTFDLDA DLTPLFNWNTKQVFVYLQADYDGGAARPDIQNSVSFWDRIITTKDKAVLHLKNQRGFYSVYDVQKSFNANNATLKLGYNI QPYVGALIFGHFDVDGTSEIQFASP
GO term prediction
Biological Process
GO:0006465 signal peptide processing
Molecular Function
GO:0008233 peptidase activity
Cellular Component
GO:0005787 signal peptidase complex
GO:0016021 integral component of membrane