Protein

MCA_00050_1

Length
272 amino acids

Browser: contigA:119825-121419-

RNA-seq: read pairs 2405, FPKM 108.9, percentile rank 80.2% (100% = highest expression)

Protein function

EGGNOG:0PQ6IFG09864.1factor srp1
CGD closest match:CAL0000199454SLR1Slr1p

Protein alignments

%idAln lengthE-value
UniRef50_A0A0F8B36659.74%775e-22Pre-mRNA-splicing factor srp1 n=98 Tax=Dikarya TaxID=451864 RepID=A0A0F8B366_CERFI
A0A1E3PLZ9_9ASCO69.70%667e-25Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82112 PE=4 SV=1
MIA_04055_142.86%1194e-24MIA_04055_1
Q6CEW5_YARLI54.32%814e-22YALI0B12364p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12364g PE=4 SV=1
A0A1D8PIP0_CANAL41.25%809e-13Slr1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLR1 PE=4 SV=1
A0A060TDZ0_BLAAD50.91%553e-12ARAD1D11330p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11330g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2338
Predicted cleavage: 28

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 272

Detailed signature matches

  1. Domain IPR000504
    RNA recognition motif domain
    1. SSF54928 (RNA-bindi...)
    2. SM00360 (rrm1_1)
    3. PS50102 (RRM)
    4. PF00076 (RRM_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. NON_CYTOPLASM... (N...)
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. mobidb-lite (disord...)

Protein sequence

>MCA_00050_1
MPRTTLYITGFSLGVRARDLALEFERYGPIIRCDIPSPRGNPYAFIEFEDYRDAKDAFYSMHKHRLRSGDIIHVEWAKTP
YKKSYRSPPPKRRRYSTSPPPLSARHHRHSSSRRSGSKDRDISRSRSPPPRRRYSDSRSPPPRRRRGSYDYNDRDGRRER
SISPRDDRRARNSERSPRRSSYDGGRSPARSSARSPVRSPVRSPARSPVRSPARSPVRSPVRSPVRSPVRSPVRSPARSP
VRSPVRSPARSPVRSPVRSPARSPSRSPEREN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding

Cellular Component

None predicted.