Protein

MCA_00037_1

Length
150 amino acids


Gene name: SRX1

Description: Sulfiredoxin

Browser: contigA:89120-89573+

RNA-seq: read pairs 4207, FPKM 344.3, percentile rank 92.7% (100% = highest expression)

Protein function

Annotation:SRX1Sulfiredoxin
KEGG:K12260SRX1 sulfiredoxin [EC:1.8.98.2]
EGGNOG:0PNZ8SRX1K12260 sulfiredoxin EC 1.8.98.2
SGD closest match:S000001569SRX1Sulfiredoxin
CGD closest match:CAL0000196707orf19.3537Sulfiredoxin

Protein alignments

%idAln lengthE-value
MIA_04039_156.97%1651e-60MIA_04039_1
A0A1E3PDY2_9ASCO38.93%1496e-31Sulfiredoxin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53241 PE=3 SV=1
UniRef50_A0A1E3PDY238.93%1492e-27Sulfiredoxin n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PDY2_9ASCO
A0A0J9XHH7_GEOCN38.51%1481e-30Similar to Saccharomyces cerevisiae YKL086W SRX1 Sulfiredoxin (Partial) (Fragment) OS=Geotrichum candidum GN=BN980_GECA16s02930g PE=4 SV=1
Q59ZI2_CANAL39.04%1461e-25Sulfiredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3537 PE=3 SV=1
Q6C8V4_YARLI37.58%1491e-25Sulfiredoxin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D16709g PE=3 SV=1
SRX1_YEAST37.09%1514e-23Sulfiredoxin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRX1 PE=1 SV=1
A0A1E4TL25_9ASCO36.11%1443e-22Sulfiredoxin OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30594 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6610

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 150

Detailed signature matches

    1. PIRSF017267 (Sulfir...)
    1. PF02195 (ParBc)
    2. SSF110849 (ParB/Sul...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd16395 (Srx)
  2. mobidb-lite (disord...)

Residue annotation

  1. peroxiredoxin bind...
  2. active site cd16395
  3. ATP binding site c...
  4. phosphorylation si...

Protein sequence

>MCA_00037_1
MSIQTSNNKQIMYLPRHLIRRPILPVLDEEKITAMRETMDKHYKNRPKVVTEKGKELLEKGLPIPVSEIDEGKSPEGGSS
NDSQFEDMTPIDVLMVSDKGQRYYFGFGGCHRFQAYDRSEWDLVKVKITPTTKSQLRIYLGASVDSIFKD

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0032542 sulfiredoxin activity

Cellular Component

None predicted.